KEGG   Acidovorax avenae: Acav_1257Help
Entry
Acav_1257         CDS       T01445                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aaa  Acidovorax avenae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acav_1257
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_1257
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acav_1257
Enzymes [BR:aaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acav_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1400839..1402284
Genome map
AA seq 481 aa AA seqDB search
MRYLSTRGHADRKSFCEILLEGLAPDGGLYLPEHYPQIDDAALTRLRAAYHEQGYAELAF
QILSLYIDDIPAADLKRLCEKTYTAEVFGTGEIVPLRHLENSLWLEALSNGPTLAFKDMA
MQLLGNLFEYELGRRGEELNILGATSGDTGSAAEYAMRGKRGIRVFMTSPHGRMSAFQQA
QMFSLQDANIFNIAIEGVFDDCQDIVKAVSNDLEFKRRFKIGTVNSINWARLLAQVVYYF
AGYVQATESNDQKVSFTVPSGNFGNVCAGHVARMMGLPIDRLVVATNENDVLDEFFRTGI
YRVRGSADTHETSSPSMDISKASNFERFVFDLLGRDAEATRRLFGEAVVREGRFDLSSDP
RFAEAASRYGFVSGRSTHADRIATIRDTFQRFGITIDTHTADGVKVAREHTDPGVPMLVL
ETALPIKFAETIQEALGHAPERPAKFDGIESLPKRVQVMPADVDLVKAYITRHCDGAAAA
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacctctccacccgcggccacgcggaccgcaagagcttctgcgagatcctgctc
gaaggcctggcgcccgacggcgggctgtacctgccggagcattacccgcagatcgacgac
gccgcgctcacgcggctgcgcgcggcctaccatgagcagggctacgcggagctggcattc
cagatcctgtcgctctacatcgacgacatcccggctgccgacctcaagcgcctgtgcgag
aagacgtacacggccgaggtgttcggcacgggcgagatcgtgccgctgcgccacctggag
aacagcctgtggctggaggcgctctccaacggccccacgctggcgttcaaggacatggcg
atgcaactgctgggcaacctgttcgagtacgaactgggccggcgcggcgaggagctgaac
atcctgggcgcgaccagcggcgacacgggcagcgcggccgagtacgcgatgcgcggcaag
cgcggcatccgcgtgttcatgacgagcccgcacggccgcatgagcgccttccagcaggcg
cagatgttcagcctgcaggatgcgaacatcttcaacatcgccatcgaaggcgtgttcgac
gactgccaggacatcgtcaaggccgtgagcaacgacctggagttcaagcgccgcttcaag
atcggcacggtgaactcgatcaactgggcccggctgctcgcccaggtggtgtactacttc
gcgggctacgtgcaggccaccgagtcgaacgaccagaaggtcagcttcacggtgccctcg
ggcaatttcggcaacgtctgcgcgggccatgtggcgcgcatgatgggcctgcccatcgac
aggctcgtggtggcgaccaacgagaacgacgtgctcgacgagttcttccgcacgggcatc
taccgcgtgcgcggcagcgccgacacgcacgagacgtcgagcccctcgatggacatcagc
aaggccagcaatttcgagcgcttcgtgttcgacctgctgggccgtgacgcggaggccacg
cgccggctgttcggcgaagccgtggtgcgcgagggccgcttcgacctgagcagcgatccg
cgcttcgccgaggctgcgtcgcgctacgggttcgtgagcgggcgcagcacgcacgcggac
cgcatcgcgaccatccgcgacaccttccagcgcttcggcatcacgatcgacacccacacg
gctgacggcgtgaaggtggcacgcgagcacaccgatccgggcgtgccgatgctggtcctg
gaaaccgccctgcccatcaagttcgccgagacgatccaggaggccctgggccatgcgccc
gagcgccccgcgaagttcgacggcatcgagagcctgcccaagcgcgtgcaggtgatgccg
gccgacgtggacctggtgaaggcctacatcacgcgccattgcgacggggcggccgcggcg
gcctga

DBGET integrated database retrieval system