KEGG   Acidovorax avenae: Acav_1280Help
Entry
Acav_1280         CDS       T01445                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aaa  Acidovorax avenae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acav_1280
   01230 Biosynthesis of amino acids
    Acav_1280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_1280
   00051 Fructose and mannose metabolism
    Acav_1280
   00562 Inositol phosphate metabolism
    Acav_1280
Enzymes [BR:aaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acav_1280
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acav_1280
  Exosomal proteins of bladder cancer cells
   Acav_1280
  Exosomal proteins of melanoma cells
   Acav_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1423528..1424283
Genome map
AA seq 251 aa AA seqDB search
MTKKKLIAGNWKMNGALGANAALLQALRGGLEAGAFQNVDVAVAVPAAYLAQVQGLAEGS
AIALAAQDVSRHEVGAYTGEISAAMLQEFGVRYVLVGHSERRQYHGETDEQVAEKAQRAL
AAGITPVVCVGETLAEREAAQTEAVVKRQLAAVIHLNGHCISETVVAYEPVWAIGTGRTA
TPEQAQQVHAVLRAQLAAASEHADRIRLLYGGSMNAANAATLLAQPDIDGGLVGGASLKA
QDFLQIIAAAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaagaaactcatcgcgggcaactggaagatgaatggcgccctgggcgccaat
gccgcgttgctgcaggcgctgcgtggcggcctcgaggcgggcgcgttccagaacgtggat
gtggccgtggcagtgccggcggcctacctcgcacaggtgcagggcctggccgaaggctcg
gccatcgcgctggcggcgcaggatgtgtcgcggcacgaagtgggtgcctacacgggtgaa
atctccgcggcgatgctgcaggaattcggcgtgcgctacgtgctggtcgggcattccgag
cgccgccagtaccacggcgagaccgacgagcaggtggccgagaaggcgcagcgcgcgctg
gccgccggcatcacgccggtcgtgtgcgtgggcgagacgctggccgagcgcgaggccgcg
cagaccgaggccgtggtcaagcgccagctggccgcggtcatccacctgaacggccattgc
atcagcgagaccgtggtggcgtacgagcccgtctgggccatcggcaccggccgcaccgcc
acgcccgagcaggcgcagcaggtgcatgccgtgctgcgcgcgcagctggcagcggccagc
gagcacgcggaccgcatccgcctgctctacggcggcagcatgaacgccgcgaatgcggcc
acgctgctggcccagcccgacatcgacgggggcctcgtgggcggcgcatcgctcaaggcc
caggactttttgcagatcatcgcagcggcagcctga

DBGET integrated database retrieval system