KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_1329Help
Entry
Acav_1329         CDS       T01445                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aaa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aaa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1473780..1474949
Genome map
AA seq 389 aa AA seqDB search
MIFMFRIRKKNFSYGSLGKKIEAESQPIRTTRLFPVSQCHRSLPDGHPRTLSHRAARQHL
VSIDDWSRGDIENLLDVTEDIRRHPGEFAYSLAGSLVCTAFFEPSTRTRLSFEAAAHRLG
AKVLSMGDMQTTRMGLGESASDTLRMAGYYADLVVARHAQDGMVERMAQALEVPVVNAGE
GLHRHPTQTLIDLFTMRKHFGTLDGLRVGICGGLRYSRAAKSLLAGLRAFRDVRVHVVDA
VGDTEAAQAQRAPLAQVAGAGAQEHACVADMLGQVDVLYVVRVQREQYRDEASHAMQLER
CRVDRRLLQGLRGDLVVMHCLPRGGELPEDVDDTPFNHYFRQAANGVAVRMAVLQRYLGR
FRLTTAALMGDRLHLDIAPPSSANRSVAW
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatttttatgtttcgtataagaaagaaaaacttctcttatggaagcctcggaaagaag
attgaagcagaaagtcagcccatccgcacaacaagattgtttccagtgtcgcagtgccac
cgctccctgcccgatgggcatccacgcaccctttcccacagggctgcgcgccagcatctc
gtgtcgatcgacgactggtcgcgcggggatatcgagaacctgctggacgtgacggaagac
atccgccgccatccgggcgaattcgcctacagcctcgcaggctcgctcgtctgcaccgcg
ttcttcgagcccagcacccgcacgcgcctgagcttcgaggcggccgcccaccggctgggc
gcgaaggtgctgagcatgggcgacatgcagaccacccgcatgggcctgggcgagagtgct
tccgacaccctgcgcatggcaggctactacgcggacctggtcgtggcgcggcatgcgcag
gacggcatggtggagcgcatggcgcaggcgctcgaggtgcccgtggtgaacgcgggcgaa
ggcctgcatcgccatccgacgcagaccctgatcgacctcttcaccatgcgcaagcacttt
ggcacgctggacggcctgcgcgtgggcatctgcggagggctgcggtactcccgggcggcc
aagtcgctgttggccgggctgcgggccttccgcgacgtgcgggtgcatgtggtggatgcg
gtaggcgataccgaggcggcgcaggcgcagcgcgcaccgctggcgcaggtcgccggggcg
ggtgcccaggagcacgcctgcgtggccgacatgctgggccaggtggatgtgctctatgtc
gtgcgcgtgcagcgcgagcagtaccgcgacgaggcctcccacgcgatgcagctggagcgc
tgccgcgtcgatcgccgcctgctgcagggcctgcggggcgacctggtggtgatgcactgc
ttgccccgcggcggagaactccccgaggacgtggacgacacgcccttcaaccactacttc
cggcaggcggccaacggcgtggccgtgcgcatggcggtactccagcgctacctgggccgg
ttccgcctgacgacggcagccctgatgggcgaccggctgcacctggacatcgctcccccg
tcttccgccaacaggtccgtcgcatggtga

DBGET integrated database retrieval system