KEGG   Acidovorax avenae: Acav_1451Help
Entry
Acav_1451         CDS       T01445                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1608284..1609834)
Genome map
AA seq 516 aa AA seqDB search
MADRPPSEIARETLKQLAARRLAPTPDNYQALYEEIAGTRTAPAFPDAQLRHILRVLPGQ
TPAQKRLLGQFEAAIEQGDWSQLQGVLVGYANLGLHAGGATPVETAPAPLTGAPAGAATV
LPEDMAEQLARLVDNTLPALGEDDARVHELAAQLTQFLRQPAPPVSTLALMLNNFSYRLS
FATEDQAAIRSGLLALLHMVFENISVLSQDDQWLQGQAEALKAASTPPLTLRRLDDVQRR
LKDVIFKQNEARERSVQAQQQMKELLATFIERLAQITASSSTYHEKMERCAEQIGQATSL
DQITPLLEEVMGATRAMALDTRLTRDELQELRERSEARHAEIAKLQEELDRASAQARHDP
LTGSLNRKGLDEALDREVARALRNDAPLCVALLDLDNFKAINDRLGHTGGDEALKHLAGV
TREVMRPQDQLARYGGEEFVIILPDTSLAQGVEAMARLQRELTTRYFLKDQEKVLITFSA
GVAQLAPQETTVEAIRRADQGMYLAKRSGKNRVMAA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgccccccttcagagatcgcgcgagaaaccctcaaacagctggcggcccgc
cgcctcgcgcccaccccggacaactaccaggcgctgtacgaggagatcgccggcacgcgc
acggccccggcttttcccgatgcgcaactgcgccacatcctgcgggtgctccccggccag
acgcctgcccagaagcggctgctcggccagttcgaggcggccatcgagcagggggactgg
tcacagctccagggcgtgctggtgggctatgccaacctgggcctgcatgccggcggcgcc
actccggtggagacagccccggcaccgctgacgggcgccccggcaggcgccgccacggtg
ctgcccgaagacatggcggagcaactggcccggctggtcgacaacacgctgccggcgctg
ggcgaggacgatgcgcgcgtccatgagctggcggcgcaactcacgcagttcctgcgccag
cccgcaccgccggtgtccacgctggcgctgatgctcaacaacttcagctaccggctctcc
ttcgccaccgaggaccaggcagcgatccgctccggccttctggccctgctgcacatggtg
ttcgagaacatctcggtgctgagccaggacgaccaatggctgcaggggcaggccgaggcc
ctcaaggcggcctccacgccaccgctcacgctgcggcggctggacgacgtgcagcgccgg
ctcaaggacgtgatcttcaagcagaacgaggcgcgcgagcgctccgtgcaggcacagcag
cagatgaaggagctgctggccacgttcatcgagcggctcgcgcagatcaccgcgtccagc
agcacttaccacgagaagatggagcgctgcgccgagcagatcgggcaggccacgagcctg
gaccagatcacgccgctgctcgaggaggtgatgggcgcgacccgcgccatggcgctcgac
acgcgcctgacgcgcgacgaactgcaggagctgcgcgagcgctccgaggccaggcatgcc
gagatcgccaagctgcaggaggaactggaccgggccagcgcccaggcgcggcacgatccg
ctgaccggctcgctgaaccgcaagggcctggacgaggcgctggaccgcgaagtggcacgc
gcgctgcgcaacgacgcgccgctgtgcgtcgcgctgctggacctggacaatttcaaggcc
atcaacgaccggctggggcatacgggcggggatgaggcactcaagcacctcgcgggcgtg
acgcgcgaggtgatgcgcccgcaggaccagctcgcccgctacgggggcgaggagttcgtg
atcatcctgccggacacctccctggcccagggcgtggaggccatggcccgcctgcagcgt
gaactgaccacgcgctacttcctcaaggaccaggaaaaggtgctcatcaccttcagcgcc
ggcgtggcgcagcttgcgccgcaggagacgacggtggaagcgatccggcgggcggaccag
ggcatgtacctcgccaagcgctcgggcaagaaccgtgtcatggcggcctga

DBGET integrated database retrieval system