KEGG   Acidovorax avenae: Acav_1454Help
Entry
Acav_1454         CDS       T01445                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aaa  Acidovorax avenae
Brite
Enzymes [BR:aaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Acav_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1611883..1612668
Genome map
AA seq 261 aa AA seqDB search
MHRRPGFPARLDTPSAPGAPRAPAPARPPLPAGAPAAVPVPHGLGLDSAAVRARMVQRLA
AGGITSPAVLQAMGTVERHRFVDTALVNQAYEDTSLPIGLGQTISKPSIVARMTELLLGA
EGARAGGLGRVLEIGTGCGYQAAVLARVAREVYTIERLRALHEKARDNLRPWRLTNAHLI
LGDGMAGYAKGAPYAAIIAAAGGETIPDAWVQQLAVGGRLVAPMAAAGGRQVLVVIDRTP
HGLQQSTLEAVHFVPLKSGIA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggcggcccggttttcccgcccggctcgacacgccgtcggcacccggtgcgcca
cgcgcgccggcgcccgcgcgacccccgctgcctgccggcgcgccggcggccgtaccggtg
ccgcacggcctgggcctggattcggccgccgtgcgcgcccgcatggtgcagcgcctcgcc
gccggcgggatcacgtcgcccgccgtgctccaggccatgggcacggtggagcggcaccgt
ttcgtggacaccgcgctcgtcaaccaggcctacgaggacaccagcctgcccatcgggctc
gggcagacgatctccaagcccagcatcgtggcccgcatgaccgaactgctgctgggcgcc
gagggcgcccgcgcaggcggcctggggcgcgtgctggagatcggcaccggctgcggctac
caggccgcggtgctcgcccgggtggcgcgcgaggtgtacaccatcgagcggctgcgcgcg
ttgcatgagaaggcccgcgacaatctgcggccctggcggctgaccaatgcgcacctgatc
ctgggcgacggcatggccggctacgccaagggtgcgccctatgccgccatcatcgctgcc
gcgggcggtgaaaccattcctgacgcctgggtccaacagctcgccgtgggagggcgcctc
gtcgcccctatggccgcggcgggcgggcggcaggtcctcgtcgtgatcgacaggactccc
cacgggcttcagcagagcacgttggaggccgtacattttgtccccctaaaatcggggatt
gcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system