KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_1539Help
Entry
Acav_1539         CDS       T01445                                 

Definition
acetate/CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aaa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aaa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aaa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aaa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:aaa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1719821..1721815
Genome map
AA seq 664 aa AA seqDB search
MSASSSTIESVLVENRVFPPPAACEKGARISGMAGYEALCAEAERDFEGFWARLARENVQ
WTRPFTRTLDESNAPFFQWFADGELNASANCLDRHIGTPVENKTAIIFEADDGAVTKVTY
RELLERVGRFANALKAEGVKKGDRVLIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKA
LQERIIDAGAVAVVTANYQMRGGKELPLKAIVDEGIAMGGCESIRSILVFQRTATACNMV
AGRDKTFDEALAGQSAECAPVPVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWARLTMD
WTFDLKPEDVFWCTADIGWITGHTYVAYGPLAAGATQVVFEGVPTYPNAGRFWQMIERHK
VSIFYTAPTAIRSLIKAAEADKAVHPSSSDLSSLRILGSVGEPINPEAWMWYHKNVGGER
CPIVDTFWQTETGGHVITPLPGATPLVPGSCTLPLPGITAAIVDESGNDIPNGTGGILVI
KRPWPSMIRTIWNDPERFKKSYFPEELKGYYLAGDGAVRSADRGYFRITGRIDDVLNVSG
HRMGTMEIESALVSKTDLVAEAAVVGRPDDLTGEAICAFVVLKRPRPTGDEARAIAKELR
DWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEAITQDTSTLENPAILDQL
AQAN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtcatcgtccacgatcgaatccgtgctggtggaaaaccgcgtcttccccccg
cccgccgcctgcgagaagggtgcgcgcatctccggcatggccggctacgaggccctgtgc
gccgaggccgaacgtgatttcgaaggcttctgggcacgcctggcacgcgagaacgtgcag
tggaccaggcctttcacccgcacgctggacgagtccaacgccccgttcttccagtggttc
gccgacggcgagctgaacgccagcgccaactgcctggaccgccacatcggtacgccggtc
gagaacaagaccgcgatcatcttcgaagccgacgacggcgccgtcaccaaggtcacctac
agggagctgctggagcgcgtgggccgcttcgccaacgcgctcaaggccgagggcgtgaag
aagggcgaccgcgtgctgatctacatgcccatgaccatcgagggcgtggtggcgatgcag
gcctgcgcgcgcatcggcgccacgcacagcgtggtgttcggcggcttctcggccaaggcg
ctgcaggagcgcatcatcgacgcgggcgcggtggccgtggtcaccgccaactaccagatg
cgcggcggcaaggaactgccgctcaaggccatcgtcgatgaaggcatcgccatgggcggc
tgcgaatcgatccgcagcatcctcgtcttccagcgcaccgccacggcctgcaacatggtg
gcaggccgcgacaagaccttcgatgaagccctggccggccagagcgccgagtgcgcgccc
gtgcctgtcggcgcggagcatccgctcttcatcctctacaccagcggttcgaccggcaag
cccaagggcgtgcagcactccaccggcggctacctgctgtgggccaggctcacgatggac
tggaccttcgacctcaagcccgaggacgttttctggtgcacggccgacatcggctggatc
accggccacacctacgtggcctacggcccgctcgccgccggcgccacgcaggtcgtgttc
gagggcgtgcccacctacccgaacgccggccgcttctggcagatgatcgagcgccacaag
gtctcgatcttctacaccgcgcccacggccatccgctcgctcatcaaggcggcagaagcc
gacaaggcggtccacccgtccagctccgacctgtccagcctgcgcatcctgggcagcgtg
ggcgagcccatcaaccccgaggcctggatgtggtaccacaagaacgtgggcggcgagcgc
tgccccatcgtggacaccttctggcagaccgagaccggcggccacgtcatcaccccgctg
ccgggcgccacgccgctggtgccgggctcctgcacgctgccgctgcccggcatcaccgcc
gccatcgtcgatgaatccggcaacgacattcccaacggcacgggcggcatcctggtcatc
aagcgcccctggcccagcatgatccgcaccatctggaacgatccggagcgcttcaagaaa
agctacttccccgaagagctcaagggctactacctggcgggcgacggcgcggtgcgcagt
gccgaccgcggctacttccgcatcaccggccgcatcgacgacgtgctgaacgtctcgggc
caccgcatgggcacgatggagatcgaatcggcccttgtctccaagaccgacctcgtggcc
gaggccgccgtggtgggccgccccgacgacctgaccggcgaggcgatctgcgccttcgtg
gtcctgaagcgcccgcgccccacgggcgacgaggccagggccatcgccaaggagctgcgc
gactgggtggccaaggagatcggaccgatcgccaagccgaaggacatccgcttcggcgac
aacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgctccatcgccaag
ggcgaggcgatcacgcaggacacgagtacgttggaaaaccccgcgatcctggaccagttg
gcgcaagccaactga

DBGET integrated database retrieval system