KEGG   Acidovorax avenae: Acav_1549Help
Entry
Acav_1549         CDS       T01445                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
aaa  Acidovorax avenae
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Acav_1549
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Acav_1549
Enzymes [BR:aaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Acav_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1728956..1730461
Genome map
AA seq 501 aa AA seqDB search
MNAASEWITRSVARLRTEAPIADLDAAGAAGGGRPPAAAAPAPAPAPAPAKAPPPRSTSE
RMAATLRRANEALSPRALRRLLADLQAVAAPQASEVEGGRQAEAVAAWYAEAKPEERRDM
WLLMCEQFAPDATRFKSAQKRYEAAAGTEDEAHAEVHLRRALVSPRTRLLQRFAVFPQGM
RFLVDLRAELLPQLKGDKRLLPLDAELEQLFSTWFDVAFLELQRLSWDSPASLLEKLIKY
EAVHDIRSWADLKNRLDSDRRCYGFFHPRLPNEPLIFVEVALVNEISDSITPLLDEDGAA
VDIARANTAIFYSISNTQTGLRGVSFGDSLIKHVVETLSAEFPRLRTFATLSPIPGFRAW
FGKHCAGMLEAMDDKRRTELGRAIGAEAPQAAQVIAAAEKALELPVKSPLRQWLLHCAAR
YLGRELQDGRPVDGVARFHLGNGARVERLNWAGDPSSKGQKQSFGLMVNYLYDLKRIDKH
RALLAQGRVPVSGDIDSLARG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcctccgaatggatcacgcgcagtgtcgcccgcctgcgcaccgaagccccg
atcgccgacctcgatgccgcgggcgcggcaggaggtggccgcccgcccgctgctgctgcc
ccggccccggccccggcccctgcgccggccaaggcaccgccgccgcgttccacgtccgag
cgcatggccgccacgctgcggcgcgcgaacgaggccctgtccccgcgcgctctgcgccgg
ctgctggccgacctgcaggcggtcgcggcgccgcaggccagcgaggtggagggcggccgg
caggccgaggccgtggccgcctggtatgcggaggccaagcccgaagagcgccgcgacatg
tggctgttgatgtgcgagcagttcgcgcccgatgccacgcgcttcaagtcggcgcagaag
cgctacgaggctgcagccggcacggaagacgaggcgcacgcggaagtccatctgcgccgc
gccctggtctcgccgcgcacgcggctgctgcagcggttcgcggtgttcccgcagggcatg
cgcttcctcgtggacctgcgcgcggaactgctgccgcagctcaagggcgacaagcggctg
ctgccgctggacgcggaactggagcagttgttctccacgtggttcgacgtggccttcctg
gagctgcagcgcctgtcgtgggattcgccggcgtcgctgctggaaaagctcatcaagtac
gaggccgtgcacgacatccgcagctgggcggacctgaagaaccggctcgacagcgaccgc
cgctgctatggtttcttccacccgcggctgccgaacgagccgctcatcttcgtcgaggtg
gcgctggtcaacgagatttcggacagcatcacgccgctgctggacgaggatggcgcggcc
gtggacatcgcccgcgccaacacggcgatcttctattcgatcagcaacacgcagacgggc
ctgcgcggcgtgagcttcggcgattcgctcatcaagcatgtggtggagacgctgtcggcc
gagttcccgcggctgcggaccttcgccacgctctcgccgattccgggtttccgcgcatgg
ttcggcaagcactgcgcaggcatgctcgaagccatggacgacaagcgccgcaccgaactg
ggccgtgccatcggggcggaggcgccgcaggccgcgcaggtgatagccgcggcagagaag
gcgctggagctgcccgtgaagtcgccgctgcggcagtggctgctgcactgcgcggctcgc
tacctggggcgcgaactgcaggacggccgccccgtggatggggtggcgcgcttccacctc
ggcaacggggcgcgcgtggagcggctcaactgggcgggggacccgtcgtccaaggggcag
aagcagtcgttcggcctcatggtgaactacctctacgacctcaagcgcatcgacaagcac
cgggcgctcctggcccagggccgcgtaccggtgtcgggagacatcgacagcctcgcccgc
ggctga

DBGET integrated database retrieval system