KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_1549Help
Entry
Acav_1549         CDS       T01445                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aaa00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:aaa00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1728956..1730461
Genome map
AA seq 501 aa AA seqDB search
MNAASEWITRSVARLRTEAPIADLDAAGAAGGGRPPAAAAPAPAPAPAPAKAPPPRSTSE
RMAATLRRANEALSPRALRRLLADLQAVAAPQASEVEGGRQAEAVAAWYAEAKPEERRDM
WLLMCEQFAPDATRFKSAQKRYEAAAGTEDEAHAEVHLRRALVSPRTRLLQRFAVFPQGM
RFLVDLRAELLPQLKGDKRLLPLDAELEQLFSTWFDVAFLELQRLSWDSPASLLEKLIKY
EAVHDIRSWADLKNRLDSDRRCYGFFHPRLPNEPLIFVEVALVNEISDSITPLLDEDGAA
VDIARANTAIFYSISNTQTGLRGVSFGDSLIKHVVETLSAEFPRLRTFATLSPIPGFRAW
FGKHCAGMLEAMDDKRRTELGRAIGAEAPQAAQVIAAAEKALELPVKSPLRQWLLHCAAR
YLGRELQDGRPVDGVARFHLGNGARVERLNWAGDPSSKGQKQSFGLMVNYLYDLKRIDKH
RALLAQGRVPVSGDIDSLARG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcctccgaatggatcacgcgcagtgtcgcccgcctgcgcaccgaagccccg
atcgccgacctcgatgccgcgggcgcggcaggaggtggccgcccgcccgctgctgctgcc
ccggccccggccccggcccctgcgccggccaaggcaccgccgccgcgttccacgtccgag
cgcatggccgccacgctgcggcgcgcgaacgaggccctgtccccgcgcgctctgcgccgg
ctgctggccgacctgcaggcggtcgcggcgccgcaggccagcgaggtggagggcggccgg
caggccgaggccgtggccgcctggtatgcggaggccaagcccgaagagcgccgcgacatg
tggctgttgatgtgcgagcagttcgcgcccgatgccacgcgcttcaagtcggcgcagaag
cgctacgaggctgcagccggcacggaagacgaggcgcacgcggaagtccatctgcgccgc
gccctggtctcgccgcgcacgcggctgctgcagcggttcgcggtgttcccgcagggcatg
cgcttcctcgtggacctgcgcgcggaactgctgccgcagctcaagggcgacaagcggctg
ctgccgctggacgcggaactggagcagttgttctccacgtggttcgacgtggccttcctg
gagctgcagcgcctgtcgtgggattcgccggcgtcgctgctggaaaagctcatcaagtac
gaggccgtgcacgacatccgcagctgggcggacctgaagaaccggctcgacagcgaccgc
cgctgctatggtttcttccacccgcggctgccgaacgagccgctcatcttcgtcgaggtg
gcgctggtcaacgagatttcggacagcatcacgccgctgctggacgaggatggcgcggcc
gtggacatcgcccgcgccaacacggcgatcttctattcgatcagcaacacgcagacgggc
ctgcgcggcgtgagcttcggcgattcgctcatcaagcatgtggtggagacgctgtcggcc
gagttcccgcggctgcggaccttcgccacgctctcgccgattccgggtttccgcgcatgg
ttcggcaagcactgcgcaggcatgctcgaagccatggacgacaagcgccgcaccgaactg
ggccgtgccatcggggcggaggcgccgcaggccgcgcaggtgatagccgcggcagagaag
gcgctggagctgcccgtgaagtcgccgctgcggcagtggctgctgcactgcgcggctcgc
tacctggggcgcgaactgcaggacggccgccccgtggatggggtggcgcgcttccacctc
ggcaacggggcgcgcgtggagcggctcaactgggcgggggacccgtcgtccaaggggcag
aagcagtcgttcggcctcatggtgaactacctctacgacctcaagcgcatcgacaagcac
cgggcgctcctggcccagggccgcgtaccggtgtcgggagacatcgacagcctcgcccgc
ggctga

DBGET integrated database retrieval system