KEGG   Acidovorax avenae: Acav_2001Help
Entry
Acav_2001         CDS       T01445                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aaa  Acidovorax avenae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acav_2001
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acav_2001
  Amino acid metabolism
   00310 Lysine degradation
    Acav_2001
Enzymes [BR:aaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acav_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2231030..2232307
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLSWKKKAGEAVAIDEILIEIETDKVVLEVPAPAAGVLAEI
VQGDGATVVADQVIARIDTEGKAGAAAPAQSAPTAAAQAPAVAAAAADAAPAGGSKGDVA
MPAAAKLLADNNLSVSAVSGSGKDGRVTKGDVLAAVAGGAAAKPSAAPAAIPTGVPTKAL
PQVASPAAPNLGDRPEQRVPMSRLRARIAERLLQSQSTNAILTTFNEVNMAPVMELRKKF
QDSFTKEHGTKLGFMSFFVKAAVHALKKFPVLNASVDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQMSFADIEKKIAEFGKKAQEGKLGIEEMTGGTFSISNGGTFGSMLSTPIINP
PQSAILGVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPAR
LLFDI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccaactgtccgaatccgtggccgaggccacgatg
ctctcctggaagaagaaggccggcgaggccgtcgccatcgatgagatcctgatcgagatc
gagaccgacaaggtcgtgctcgaagtgcccgcgccggccgccggcgtgctggccgagatc
gtccagggcgacggtgccaccgtcgtggccgaccaggtcatcgccaggatcgacaccgaa
ggcaaggccggcgccgccgcgcccgctcagtccgctccgaccgccgccgcccaggcgccc
gccgtggccgccgcagcggccgacgccgcccctgcaggcggttcgaagggcgacgtggcc
atgccggccgccgccaagctgctggccgacaacaacctgtccgtgtcggccgtgtccggc
tccggcaaggatggccgcgtgaccaagggcgacgtgctggccgccgtggccggtggcgct
gccgccaagccgtccgctgcccccgccgccatccccacgggcgtgcccaccaaggcgctg
ccgcaggtggcatcccccgccgcaccgaacctgggcgaccgccccgagcagcgcgtgccg
atgagccgcctgcgcgcccgcatcgccgagcgcctgctgcagtcgcagtccaccaacgcc
atcctgaccaccttcaacgaggtgaacatggccccggtgatggagctgcgcaagaagttc
caggacagcttcaccaaggagcacggcaccaagctgggcttcatgagcttcttcgtgaag
gcggccgtgcacgcgctcaagaagttcccggtgctgaacgcttcggtggacggcaacgac
atcgtttatcacggctacttcgacatcggcatcgccgtcggctcgccccgcggcctggtg
gtgccgatcctgcgcaacgccgaccagatgagcttcgccgacatcgagaagaagatcgcc
gagttcggcaagaaggcccaggaaggcaagctcggcatcgaggagatgacgggcggcacg
ttctcgatctccaatggcggcaccttcggttccatgttgtccacccccatcatcaacccg
ccccagtcggccatcctgggcgtgcacgccaccaaggaccgtgccgtggtggaaaacggc
cagatcgtggtgcgcccgatgaactacctggcgatgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgggcctggtggcgatgaaggacgcgctggaagatccggcccgc
ctgctgttcgatatttga

DBGET integrated database retrieval system