KEGG   Acidovorax avenae: Acav_2019Help
Entry
Acav_2019         CDS       T01445                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aaa  Acidovorax avenae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Acav_2019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_2019
  Lipid metabolism
   00071 Fatty acid degradation
    Acav_2019
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acav_2019
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acav_2019
   00626 Naphthalene degradation
    Acav_2019
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acav_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2255687..2256721)
Genome map
AA seq 344 aa AA seqDB search
MLPKTMKAAVVREFGKPLTIEEAPVPTPADDQILVKIEASGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGFVAAIGRNVKHVKEGDRVGVPWLHSACGCCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPNFVGHLPKDVGFVDIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGG
LGHMAVQYAKAMGLNVAAVDVEDDKLELAKKLGASVTVNAKTTDPAAYLQKEIGGAHGAL
VTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLPIFDMVLRGVTVRGSIVGTRLDLQES
LDFAARGQVKATVATEKLENINDVFARMHKGQIQGRIVLDMAAH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccaagaccatgaaagccgccgtcgtgcgcgaattcggcaagcccctcaccatc
gaggaagccccggtaccgacgcccgccgatgaccagatcctcgtgaagatcgaggcctcc
ggcgtctgccacaccgacctgcacgccgccgaaggcgactggcccgtcaagcccaacccg
ccgttcattcccggccacgagggcgtgggtttcgtcgcggccatcggcaggaacgtgaag
cacgtgaaggaaggcgaccgcgtgggcgtgccgtggctgcattcggcctgcggctgctgc
acccactgcctgggcggctgggaaaccctgtgcgaatcgcagagcaacaccggctattcg
gtcaacggcggtttcgccgactacgcgctggccgaccccaacttcgtgggccacctgccc
aaggacgtcggcttcgtggacatcgctcccgtgctgtgcgcgggcgtgaccgtgtacaag
ggcctgaaggtgacggacaccaagccgggcgactgggtggtcatctccggcatcggcggc
ctgggccacatggccgtgcagtacgccaaggccatgggcctgaacgtggcggccgtggac
gtggaagacgacaagctcgaactggcgaaaaaactcggcgccagcgtgacggtgaacgcg
aagaccaccgacccggccgcctatctgcaaaaggagatcggcggcgcccatggcgcgctg
gtcacggccgtctcgcccaaggccttcgagcaggcgctgggcatggtgcgccgcggcggc
accgtgtcgctcaacggcctgccgcccggcaacttcccgctgcccatcttcgacatggtg
ctgcgcggcgtcaccgtgcgcggctccatcgtcggcacgcgcctggacctgcaggaatcg
ctggacttcgcggcccgcggccaggtcaaggccaccgtggcgaccgagaagctggagaac
atcaacgacgtgttcgcgcgcatgcacaagggccagatccagggccgcatcgtgctggac
atggcggcccactga

  All links  
No link information was found.   
DBGET integrated database retrieval system