KEGG   Acidovorax avenae: Acav_2094Help
Entry
Acav_2094         CDS       T01445                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aaa  Acidovorax avenae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Acav_2094
   00240 Pyrimidine metabolism
    Acav_2094
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Acav_2094
   03430 Mismatch repair
    Acav_2094
   03440 Homologous recombination
    Acav_2094
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Acav_2094
DNA replication proteins [BR:aaa03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Acav_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2336614..2337048
Genome map
AA seq 144 aa AA seqDB search
MTEIAFHFNAPDKLAYACRFARKALRNDALLVITGPAPVLDAMDRALWALSPQDFLAHCR
QEDEPELREASPVLLAADPRTVARPDVLLNLGASVPEGFERFARLVEVVSAHDEGDRAGA
RERWRHYAQRGYGIVRHDLVLKGG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgccttccacttcaacgcgcccgacaagctggcctatgcgtgccggttt
gcgcgcaaggccctgcgcaacgacgcgctcctggtgatcaccgggcccgcgcccgtgctc
gacgcgatggaccgcgcgctgtgggccctgagcccgcaggacttcctggcgcactgccgc
caggaagacgagcccgaattgcgcgaggcctcgcccgtcctgctggcggccgacccgcgc
accgtcgcgcgccccgatgtcctgctgaacctcggggcctccgtgcccgaggggttcgag
cgcttcgcgcggctcgtcgaggtggtgagcgcgcacgacgagggggaccgggccggcgcg
cgcgagcgttggcggcactacgcgcagcggggctacggcatcgtccgccatgacctggtg
ctgaagggaggctga

DBGET integrated database retrieval system