KEGG   Acidovorax avenae: Acav_2107Help
Entry
Acav_2107         CDS       T01445                                 

Definition
(GenBank) potassium transporter
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2349535..2351409)
Genome map
AA seq 624 aa AA seqDB search
MADTKTPTSLTALTIAAIGVVYGDIGTSPLYAFKEVFAAGRLEITPANVIGILSLFFWTL
TVIVSVKYVALIMRADNHGEGGLMALLALATQSVQDQPRLKRALMTLGVFGVALFFGDGV
ITPAISVLSAVEGLEVVTTRATPYILPISLTVLLALFLAQRWGTARLGRFFGIAMLVWFA
CLGLAGIPHIAARPEVLTALLPHHALAFCLDHYGIAFITLGAVFLCVTGAEALYADMGHF
GARPIRLAWFLLVMPCLTLNYLGQGALVLDTPSAAANPFFLMMPGWATLPMVVLATAATV
IASQALISGAFSAAKQTIQLGYLPRLSVRHTSENESGQIYVPMVNWTLLAGVALAVVAFR
SSNALAAAYGISVSLVMVITTTLTFFVIRHGWKLPLPLCIAATGAFLCVDVAFFASNSLK
IAEGGWFPLLMAGVLYLVMSTWHDGRGLLRQRQNAEAIELLPFLQSILAAGTTRVDGTAV
FLTAHAGVVPGAMLHNLKHNKVLHAHNLFVHVKAGDVPRIPLREQVAVQPLADGAWNVRI
RFGFMDEPDIPRALQQAGELEGLLDPMRTSYFLARETVVPTLGAAMAVWRQKLFAQMHHS
ASSAADFLKLPNNAVVEMGSKTEM
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacgaaaacgccgacttcgctcaccgcgctcacgatcgccgcgatcggggtg
gtttacggagacatcggcacctcgccgctctacgccttcaaggaggtgttcgccgccggc
cggctggagatcacgccggcgaacgtgatcggcatcctctcgctcttcttctggacactg
accgtgatcgtctcggtcaagtacgtggccctgatcatgcgggccgacaaccatggcgag
gggggcctgatggcgctgctggccctggccacgcagtcggtgcaggaccagccccggctg
aaacgggccctgatgaccctcggtgtcttcggagtcgcgctgttcttcggcgatggcgtc
atcacgcctgcgatctcagtgctgtcggccgtcgagggcctggaggtcgtcaccacgcgg
gccacgccgtacatcctgccgatctcgctcaccgtgctgctcgcgctgttcctcgcccag
cggtggggaacggcgcggctcgggcggttcttcggcatcgccatgctcgtgtggttcgca
tgcctggggctcgcaggcattccccacatcgccgcgcgcccggaggtcctgaccgcgctc
ctgccccaccacgcgctggcgttctgcctggatcactacggcatcgcgttcatcacgctg
ggcgcggtcttcctgtgcgtgaccggcgcggaggcgctctatgcggacatggggcatttc
ggcgcccggcccatccggctggcgtggttcctgctggtcatgccctgcctcacgctcaac
tacctcggccagggggcactggtgctggatacgccttccgccgccgccaacccgttcttc
ctcatgatgcccggctgggccacgctgccgatggtggtactggccacggccgccaccgtc
atcgcgtcgcaggcattgatctccggcgcattctccgcggccaagcagaccatccagctg
ggatacctgccgcgcctgtcggtgcgccatacctcggagaacgaatccgggcagatctac
gtgcccatggtgaactggacgctgctcgcgggcgtggcgctggccgtggtggcgttccgc
agctccaacgccctcgccgcggcctacggcatctcggtcagcctggtcatggtcatcacc
accacgctgaccttcttcgtcatccgccatggctggaagctgccgctgccgctatgcatc
gccgccacgggcgcattcctctgcgtggacgtggccttcttcgcctcgaactcgctcaag
atcgctgaaggcggctggttccccctgctcatggccggtgtgctgtacctggtcatgtcc
acgtggcacgacggccgcggactgctgcgccagcgccagaacgccgaggcgatcgagctc
ctgcccttcctgcaatcgatcctcgcggccggaaccacccgcgtggacggcaccgccgtc
ttcctcacggcccatgccggcgtggtgcccggggccatgctgcacaacctcaagcacaac
aaggtgctgcacgcccacaacctgttcgtccatgtcaaagccggagatgtgccccgcatc
ccgctgcgggagcaggtggctgtccagccgctcgccgacggggcctggaacgtgcggatc
cgcttcggcttcatggacgagccggacatcccccgggccctccagcaggccggggagctg
gaaggcctgctggatcccatgcgcaccagctacttcctggcgcgagagaccgtcgttccc
acgctgggtgccgccatggccgtctggcggcagaagctcttcgcccagatgcaccacagc
gccagctccgcggcggatttcctgaaactgccgaacaacgcggtggtggagatggggtcg
aagacggagatgtag

DBGET integrated database retrieval system