KEGG   Acidovorax avenae: Acav_2109Help
Entry
Acav_2109         CDS       T01445                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2352701..2353537)
Genome map
AA seq 278 aa AA seqDB search
MPQYHRDTMQDTSASPSSSPSFAAAPGPMPLVVLTGASRGMGLAMARQLLQGGHALVTLS
RGTSSELEDVARHAGMPLAQWPQDLADGAQAAARLRAWLESQPASRYASATLINNAGVVP
RIAPLADSDPADLASALRIGLEAPMQLTAAFLAATRGWGVPRKVLNISSGLGRRPMASQS
AYCAAKAGMDHFTRCLALDEARQSGGARVCSLAPGVIDTDMQVHLRGADPGAFPDVQNFA
QLKATGMLTSPDEAAARVLAWLARPDFGDAPVADVREA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtaccatcgcgacaccatgcaggacacctccgcttccccctcttcctccccc
agcttcgcggccgcgcccgggccgatgcccctggtcgttctcaccggcgcctcgcgcggc
atgggcctggccatggcccggcagttgctgcagggcgggcatgcgctcgtcaccctgtcg
cgcggcacgagcagcgaactggaagacgtcgcgcggcacgccggcatgccgctggcgcaa
tggccgcaggacctcgccgatggcgcccaggccgccgcgcggctgcgtgcctggctggaa
agccagccggccagccgctacgccagtgccaccctcatcaacaacgcaggcgtggtgccg
cgcatcgccccgctggccgacagcgacccggccgatctcgccagcgcgctgcgcatcggg
ctggaggcgcccatgcagctcaccgccgcgttcctggccgccacgcgcggctggggcgtg
ccgcgcaaggtgctcaacatttcctccggcctcgggcggcggccgatggcctcgcaatcg
gcctactgcgcggccaaggccggcatggaccatttcacgcggtgcctggcgctggacgag
gcacggcagtccggaggcgcccgggtgtgctcgctggcacccggcgtgatcgacacggac
atgcaggtccatttgcgcggcgccgaccccggggcgttccccgatgtccagaacttcgcc
cagttgaaggcgaccggcatgctcacctcgcccgacgaggccgcggcgcgcgtgctggcc
tggctcgcgcggcccgatttcggcgacgcgccggtggccgacgtgcgcgaggcctga

DBGET integrated database retrieval system