KEGG   Acidovorax avenae: Acav_2113Help
Entry
Acav_2113         CDS       T01445                                 

Definition
(GenBank) antibiotic resistance transcriptional regulator, MerR family
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2357990..2359015)
Genome map
AA seq 341 aa AA seqDB search
MQRLRVGELARRTGLTVRALHHYDEIGLLRPSARSESGYRLYSEADVQRLHAIQTLRHLG
LALGDIAGLLQGGGPDPESIIAQQIQALDRQITQATELRGRLTLLRNGLVAGPAPGMGDW
LETLALMGTYGKYFSAAELQKIFGNWKRIEADWTVVRDLVRAAMDRGLPPQDPEVQRLAY
RWMGLMLHWMDGDMALLDRWGHMFRTEPGTQGRNHAPSGDMIAYIESAIQLRVALLTRYI
DLPDLYRLGHVPYTDWAALDAQVQALVARQVPPDSAEARAACRRWSELLDTLTCRDPELR
RRLLTAAASEPLLRAGTPLSEVARAYLESAQAFAQQAPGPA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggctgcgggtgggcgagctggcccggcgcaccggcctgacggtgcgcgcgctg
caccattacgacgagatcgggctgctgcggccctccgcgcgctcggaatccggctaccgc
ctctacagcgaggcggacgtgcagcggctgcatgccatccagaccctgcgccacctcggc
ctggcgctcggcgacatcgcaggcctgctgcagggcgggggtccggaccctgagtccatc
atcgcgcagcagatccaggcgctggaccggcagatcacccaggccaccgagctgcgcggc
cggctgaccctgttgcgcaacgggctggtggccggccctgcgcccggcatgggggactgg
ctggagacgctggccctgatgggcacgtacggcaagtatttcagcgccgccgagctccag
aagatcttcggcaactggaaacgcatcgaggccgactggaccgtggtacgcgacctcgtg
cgcgccgcgatggaccgcggcctgccgccccaggatccggaggtgcagcggctggcctac
cgatggatggggctgatgctgcactggatggacggcgacatggcgctgctggaccgctgg
ggccacatgttccgcaccgagccgggcacccagggccgcaaccatgcgccttccggcgac
atgatcgcctacatcgaatccgccatccagttgcgcgtggcgctgctcacccgctacatc
gacctgccggacctgtaccgcctggggcacgttccctacacggactgggcggcgctcgat
gcgcaagtgcaggccctggtcgcacggcaggtaccgccggacagcgctgaggcccgggcc
gcgtgccgtcgctggagcgagctgctggacactctgacatgccgggacccggaattgcgg
cgcaggctgctcacggccgcggccagcgagcccctgctgcgcgcgggcacccccttgagc
gaggtggcgcgcgcctacctggaatccgcgcaggcattcgcacaacaggcgccagggccc
gcttga

DBGET integrated database retrieval system