KEGG   Acidovorax avenae: Acav_2115Help
Entry
Acav_2115         CDS       T01445                                 

Definition
(GenBank) glycine dehydrogenase
  KO
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
aaa  Acidovorax avenae
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acav_2115
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_2115
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Acav_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2359596..2362562)
Genome map
AA seq 988 aa AA seqDB search
MPTPTFPPLGALENAAEFQPRHIGIDAADEQRMLSAIGEASRAALVESIVPRSIARTAPM
ELPPATTEAVALAELKAIASKNRVLRSFIGQGYYGTHTPGVILRNILENPAWYTAYTPYQ
AEISQGRMEALVNFQTMVCDLTGMPIANASMLDEATAAAEAMTLAKRSVKSKSQTLVVSG
DTHPQTIEVIRTRAEPLGITVVVADSEAEWNAAIEGDFFAAVIQYPASSGWLADWSADVE
KIHAKQAAAIVCADLLALTLLVPPGEWGADIVVGSTQRFGMPMGAGGPHAAFMACRDDFK
RSLPGRLVGVSVDAHGQPAYRLALQTREQHIRREKATSNICTAQVLPAVIASMYAVYHGP
EGLKRIAQRVASFTAILAKGLVALGHTAHHHESAFDTLCLHTKEQTGALLARAVERGANL
RVAWNDYLCISLDETTTRADIELLWSIFATDGQALPRIEDFADGVNPLIPAELLRKSAFL
THPVFNTHHSETGMLRYIRQLSDKDLALDRSMIPLGSCTMKLNATSEMIPITWPEFAQVH
PFAPADQLEGYRQLDEQLRAWLCQATGYAGISLQPNAGSQGEYAGLLAIRAYHAAQGQGH
RNICLIPSSAHGTNPASAQMVGMQVVVTACDANGNVDMDDLRAKCEQHAEKLACVMITYP
STHGVFETQVKELCQLVHRHGGRVYVDGANMNAMVGVAAPGAFGGDVSHLNLHKTFCIPH
GGGGPGVGPVCVVEDLVPYLPGHATAGAQGALEPAPGRPKLAKAPLGGSEPHAVGSVGAV
SAAPLGNAAVLPISWMYIRMMGPDGLRAATETAILSANYISARLKDHYPTLYASANGHVA
HECILDLRGFKETSGVMAEDVAKRLIDYGFHAPTLSFPVPNTLMVEPTESETLAELDRFI
DAMIAIRGEIRRIEQGEWPQDDNPLKNAPHTAHSLLGGEWTHPYPREAAAYPVAALRQAK
YWSPVGRVDNVYGDRNLFCSCVPVSDFA
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgcccaccttcccgccgcttggcgcgcttgaaaacgccgccgaattccagccc
cgccacatcggcatcgatgccgcggacgaacagcgcatgctctcggccatcggcgaggcc
tcgcgcgcggcgctggtggagagcatcgtgccgcgctccatcgcccgcactgcgccgatg
gagttgccgcccgccacgaccgaggcggtggcgctcgcggaactcaaggccatcgcctcg
aagaaccgcgtgctgcgcagcttcatcggccagggttactacggcacgcacacgccgggc
gtgatcctgcgcaacatcctggaaaaccccgcctggtacaccgcctacacgccctaccag
gccgagatctcgcagggccgcatggaggccctggtcaacttccagacgatggtgtgcgac
ctcacgggcatgcccatcgccaacgcctcgatgctggacgaagccacggccgcggccgag
gccatgacactcgccaagcgctccgtcaagtcgaagagccagacgctcgtcgtctcgggc
gacacgcatccgcagaccatcgaggtgatccgcacgcgtgccgaacccctgggcatcacg
gtggtggtggcggactccgaggccgaatggaacgccgcgatcgagggcgacttcttcgcc
gccgtgatccagtaccctgccagcagcggctggctcgccgactggagcgccgacgtggag
aagatccacgcgaagcaggctgccgcgatcgtgtgcgccgatctgctggcgctcacgctg
ctggtgccgcccggcgaatggggcgcggacatcgtcgtgggcagcacgcagcgcttcggc
atgccgatgggcgcgggtggcccgcatgccgccttcatggcctgccgcgacgacttcaag
cgctcgctgcccggccgcctcgtgggcgtgagcgtggacgcgcacggccagccggcctac
cgcctcgcgctgcagacgcgcgagcagcacatccgccgcgagaaggccacctccaacatc
tgcacggcgcaggtgctgccggcggtgatcgccagcatgtatgccgtctaccacgggccc
gaaggcctcaagcgcatcgcacagcgcgtggcgagcttcacggccatcctggccaagggc
ctcgtggcgctcggccataccgcgcaccaccacgagtcggccttcgacacgctgtgcctg
cacacgaaagagcagaccggcgcgctgctggcgcgcgccgtggagcgcggcgccaacctg
cgcgtggcctggaacgactacctctgcatctcgctcgacgaaaccacgacccgggccgac
atcgaactgctctggtcgatcttcgccaccgacgggcaggccctgccccgcatcgaggat
ttcgcggatggcgtgaacccgctgatccctgcagaactgcttcgcaagagcgccttcctc
acgcacccggtgttcaacacccaccattccgagacgggcatgctgcgctacatccgccag
ctctcggacaaggacctggcgctcgaccgcagcatgatcccgctgggcagctgcaccatg
aagctgaacgccacgagcgagatgatcccgatcacctggccggaattcgcgcaggtgcac
ccgttcgcgcccgccgaccagctggaaggctaccgccagctcgacgagcaactgcgcgcc
tggctctgccaggccacgggctacgccggcatcagcctgcagcccaacgccgggtcgcag
ggcgaatacgcgggcctgctggccatccgtgcctaccatgcggcgcagggccagggccac
cgcaacatctgcctgatcccgagcagcgcgcacggcaccaacccggccagcgcccagatg
gtgggcatgcaggtggtggtgacggcctgcgatgcgaacggcaacgtcgacatggacgac
ctgcgcgccaagtgcgagcagcatgccgagaagctcgcctgcgtgatgatcacctacccc
agcacgcacggcgtgttcgagacgcaggtgaaggaactctgccagctcgtgcaccgccac
ggcggccgcgtgtacgtggacggcgccaacatgaacgccatggtgggcgtggccgcgccc
ggcgccttcggcggcgacgtgagccacctgaacctgcacaagaccttctgcatcccgcac
ggcggcggcggccccggcgtcggccccgtctgcgtggtggaagacctcgtgccctacctg
ccgggccatgccactgctggcgcacaaggtgcgcttgagccagcgccgggccgccccaag
ctggcgaaggcccccctggggggcagcgaaccacacgcagtgggtagcgtgggggctgtc
agtgccgccccgctgggcaatgccgcggtgctgccgatcagttggatgtacatccgcatg
atgggcccggacggcctgcgcgccgccaccgagacggccatcctctcggccaactacatc
agcgcgcgcctgaaggaccactatcccacgctgtacgcgagcgccaacggccatgtggcg
cacgagtgcatcctggacctgcgcggcttcaaggagaccagcggcgtgatggccgaggac
gtcgccaagcggctgatcgactacggcttccacgcgcccacgctctccttccccgtgccc
aacacgctcatggtggagcccaccgaaagcgagacgctggccgagctggaccgcttcatc
gacgcgatgatcgccatccgcggcgagatccgccgcatcgagcagggcgagtggccgcag
gacgacaacccgctcaagaacgcgccccacaccgcgcacagcctgctgggcggcgagtgg
acgcatccctacccgcgcgaggcggcggcctatccggtcgcggcgctgcggcaggccaag
tactggtcgcccgtgggccgggtggacaacgtctacggcgaccgcaacctgttctgcagc
tgcgtgccggtgtccgacttcgcgtga

DBGET integrated database retrieval system