KEGG   Acidovorax avenae: Acav_2121Help
Entry
Acav_2121         CDS       T01445                                 

Definition
(GenBank) ABC transporter substrate binding protein
  KO
K01989  putative ABC transport system substrate-binding protein
Organism
aaa  Acidovorax avenae
Module
aaa_M00247  Putative ABC transport system
Brite
Transporters [BR:aaa02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative ABC transporter [MD:M00247] [OT]
    Acav_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_sub_bind DUF2518
Motif
Other DBs
NCBI-ProteinID: ADX46033
JGI: Acav_2121
UniProt: F0QAJ2
Position
complement(2367187..2368179)
Genome map
AA seq 330 aa AA seqDB search
MKHSFGAPWGALALAVAAVVAGTPPAVLAQQASTPKSVAVTAIVEHPALDSIRDGVKASL
QAAGYEEGKTLKWQYQSAQGNTGTAAQIARKFVGDQPDAIVAIATPSAQAVVAATKNVPV
VFSAVTDPVAAKLVANWEPSKTNVTGVSDVLALDKQMELVRQVVPGAKRVGVVYNPGEAN
SAVVVKELKTLLPKLGMTLVEAAAPRSVDVGAAARSLVGKADVIYTGTDNNVVSAYEALV
KVGQEAKLPLVAADTDSVKRGAIAAYGINYRDLGEQTGRMVVRILKGEKPGDIKPEISTK
MELFVNPGAAEKQGVKLSDALVKSAAQVVR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattcgtttggcgcgccctggggcgctctcgcgctggccgtggcggctgtcgtc
gccggcaccccgccggccgtcctggcccagcaggcctccacccccaagtccgtggcagtg
acggccatcgtcgagcacccggcactggactcgatccgcgacggcgtgaaggccagcctg
caggccgccggctacgaagagggcaagacgctcaagtggcagtaccagagcgcccagggc
aacaccggcacggccgcgcagatcgcgcgcaagttcgtgggtgaccagcccgatgccatc
gtggccatcgccacaccctccgcgcaggccgtggtggccgccaccaagaacgtgccggtg
gtgttctccgccgtgaccgatccggtggccgccaagctggtagcgaactgggagccctcc
aaaaccaacgtgaccggcgtgtccgacgtgctcgcgctcgacaagcagatggagctggtc
cggcaggtggtgcccggcgccaagcgcgtgggcgtggtctacaaccccggcgaggcgaac
tccgccgtggtggtgaaggagctcaagaccctgctgcccaagctgggcatgaccctggtg
gaggccgccgcgccgcgctcggtggacgtgggcgccgccgcgcgcagcctcgtgggcaag
gccgacgtgatctacaccggcaccgacaacaacgtggtctcggcctacgaggcgctggtg
aaggtgggccaggaggccaagctgccgctggtggccgcggacaccgacagcgtgaagcgc
ggcgccatcgccgcctacggcatcaactaccgcgacctgggcgagcagacgggccgcatg
gtggtgcgcatcctcaagggcgagaagcccggcgacatcaagccagagatcagcacgaag
atggagctcttcgtgaaccccggtgccgccgagaaacagggcgtgaagctgtccgacgcg
ctggtgaagtcggccgcgcaggtcgtccgctga

DBGET integrated database retrieval system