KEGG   Acidovorax avenae: Acav_2124Help
Entry
Acav_2124         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2371145..2372104
Genome map
AA seq 319 aa AA seqDB search
MTIAYDLPFERWASTAKVRGEIPSHQATEMDWTRGLLFTPELVPSVSHPLVARRGPEAAR
WLLAQALFSNLEFTQVLEHEVVNHAVYSIARGRSGFDLPGAMVADAWNILVDESYHGKIT
ADLSRLAEARTGIRNHAPRVPAFFLRLQREVARADPALRPLLPIFFCSISETLITKNLVE
VPRDPRVIAPIRQVMKDHAEDESKHHRFFASFIAQAWPQLPETLKAKIGPLLPKFISIFI
DPDIVFIRSQLREIGLGEDDADQVIFDCYSEASLAESRRNGARSSISALRKAGVADSAYL
RDEMHRYGLSMDIPEGVAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgcatacgacctgccgttcgagaggtgggcctccactgcgaaggtgcgcgga
gagattccgtcgcaccaggcgaccgagatggactggacccgggggcttctattcaccccg
gagctcgtgccgagcgtgtcccatcccttggtggccaggcgcggaccggaggctgccagg
tggctgctcgcccaggcattgttttcgaatctggagttcacccaggttctcgaacatgag
gtggtgaaccatgccgtctacagcattgcgcgtggcagatcgggcttcgatctgccgggc
gccatggttgccgacgcatggaacatcctggtggacgagtcctaccacggcaagatcacc
gccgacttgtcgcgtctggcggaagcgcgcacgggtattcgaaaccatgcgccaagggtg
ccggcgttctttcttcggcttcagcgtgaagtcgcgcgggccgatcccgcgctgcggccg
ctgctgccgatcttcttctgctcgatctccgagacgctcatcacgaagaacctggtcgag
gtcccccgggacccacgggtcattgcgccgatccggcaggtgatgaaagatcacgcggag
gacgagagcaagcatcaccgcttcttcgcgagcttcattgcgcaggcctggccgcagttg
cccgaaaccctgaaagccaagatcggcccgctgctgccgaagttcatatccatcttcatc
gatccggacatcgtgttcatccgcagccagctgcgggaaatcggtctcggcgaagacgat
gccgatcaggtcatcttcgactgctactccgaagcgagcctcgcggagtcccgtcgcaac
ggtgcgaggtcctccatcagtgcgctgcgcaaggcgggcgtggccgacagcgcgtacctg
cgcgatgagatgcaccggtacggcctttccatggatattcccgagggggttgcggcatga

DBGET integrated database retrieval system