KEGG   Acidovorax avenae: Acav_2125Help
Entry
Acav_2125         CDS       T01445                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_3 IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ADX46037
JGI: Acav_2125
UniProt: F0QAJ6
Position
2372101..2372799
Genome map
AA seq 232 aa AA seqDB search
MRAIILAAGVGSRIRGHTASPKCLLRIDGKTLLQHQLDALQELGVSDVHVIVGYRSKEII
GALPGHVQHHVYSQYAETNNLWTLAAFSELLQGDCLVQFADVRVSRDALRDLLCCSSDVA
LLGDGRQCLEGTMRIRARGEQLLEVGSHIPVSEGHGNFIGLARFGAAASPRLGALINRCV
QLGQRRQDYYTAVLPELCSEHRAHVVWLGGKSWAEVDDVSDLERAQAISFDA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgatcatcttggcggcaggcgtcggcagccgcatccgtgggcacacggccagt
ccgaagtgcttgctcaggatcgatggaaagaccttgctgcaacaccagctcgatgcgttg
caggaactgggggtttccgatgtccatgtcatcgtcggctaccgcagcaaggaaatcatc
ggtgcgctccccgggcatgtacagcatcacgtttattcgcagtatgcggagacgaacaac
ctctggaccctcgctgccttcagcgagctgctgcagggggactgcctggtgcagttcgcg
gacgtaagggtctcgagagacgcactgcgggatctgctgtgctgctcgtccgatgtggcg
cttcttggcgacggacgccagtgtctcgagggcacgatgcgaattcgggcgcgtggcgag
cagctgctggaggtcggcagccacattccggtgtccgaggggcacgggaacttcatcggc
ctggcacgcttcggggcagccgcttcacccaggctgggagcgctgatcaaccgatgcgtc
caactcggccagcggcgccaggactactacaccgcggtgctgcccgaattgtgctccgag
catcgggcgcatgtcgtctggcttggcggcaagtcgtgggctgaggtcgatgacgtttcc
gatctggaacgggcccaggcaatttcattcgatgcgtga

DBGET integrated database retrieval system