KEGG   Acidovorax avenae: Acav_2126Help
Entry
Acav_2126         CDS       T01445                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aaa  Acidovorax avenae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acav_2126
Enzymes [BR:aaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Acav_2126
Peptidases [BR:aaa01002]
 Cysteine Peptidases
  Family C44
   Acav_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2372838..2374826
Genome map
AA seq 662 aa AA seqDB search
MCGFVGIFHRDGQSFEEREVLNRMNQTIVHRGPDDAGMHVSGPVGLAFRRLSVIDVPGGH
QPMIDPATGVALVFNGEIYNYKELRRELEGAGAVFRTRSDTEVLLRSFIRWGAQCVDHLS
GMFAFAAWDPRSGSLTVARDRLGVKPFYWTEIGKDFLFASEVKAFFQHPRFHKRASLDGI
SSYLSFRQPVWEQTYFEGVHKLLPGEMMVVTPRQMQRRRYWALPVPRPDHRKSEAAWMEE
LHDKLNAAVRRCLVADVPLGAYLSGGLDSSILVALMARNMTTKPQTFSIGYGVHGYDEGE
FAAEVAEAVGAEHTHLTIDQREYVQGMAPLIEQCDAPLMIPQMVAVLKLSKEIRRHVKVA
LCGDGADELFGGYGRVMRSPFDWKKIHVMRRLLGPAAGSLQRFGRDPYGPVANLGCKNHL
EHFLNVYHWMPIPEKMDLLTGDARAQLKGDRATLAAFDEAFSDTEECDPHDRVLHAFQKI
HLGCVLDKVDTIGMLASLEGRVPFVDHELVETFIHMPHALKMKWRSPMSLLRALGTSAFK
ASEVLDQNKYLLRKHGQSLLPGHLAHRKKMGFPTPLDDWMKSGMLDDARALLLDQRSRER
GIFDPKRLEHFLGNPQSLDYDFYGKKVWMLMNLELWFRRVVDSQVQEPSVTASRLEAPAM
VA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctttgtgggtatttttcatcgagacggtcagtcgttcgaagaacgtgaggtg
ctgaaccgaatgaaccagaccatcgtccaccgggggcccgacgatgccgggatgcatgtc
tccgggcctgtcggtctggcctttcgccgcctgagcgtcatcgacgtaccgggtgggcat
caacccatgattgatccggccaccggcgtggcactggttttcaacggagaaatctacaac
tacaaggaactacggcgggagctcgaaggggctggggcggtgttccgcacccgctcggac
acggaggtgctgctgcgcagtttcattcgctggggcgcgcaatgcgtggatcatctctcc
ggcatgttcgcgttcgcggcgtgggacccgcgctccgggtccctgacggtggcgcgggac
cggctcggcgtcaagcccttctactggacggagatcggtaaggatttcctgttcgcatcg
gaggtcaaggcgttcttccagcatcccagattccacaagcgtgccagcctggacggcatt
tcgagctatctgtcgtttcggcagccggtctgggagcagacctacttcgaaggcgtccac
aagctgctccccggggagatgatggtggtgacgccgcggcagatgcagcgccgccgctac
tgggcgttgccggtgccccgtcctgaccatcggaaaagcgaagccgcctggatggaagag
cttcatgacaagctcaacgccgccgttcggcgctgcctcgtggcggatgtgccgctgggc
gcctacctcagtggtggcctggactcgagcatcctcgtcgccttgatggccaggaacatg
acgaccaagccgcagacgttctcgatcggctacggggttcatggctacgacgaaggcgag
ttcgcggcggaggtggcagaggccgttggcgccgagcacacccatctgacgatcgaccag
cgggagtatgtccaaggcatggcgcccttgatcgaacaatgcgatgcgccactgatgatt
ccgcagatggtcgcggttctcaagctgtcgaaggaaatccggcgccatgtgaaggtcgct
ttgtgcggcgatggcgcagatgagctgttcggcggctatgggcgggtgatgcggtcgccg
ttcgactggaaaaagatccacgtcatgcgccggctgctggggcctgccgccggttctttg
cagcgcttcggccgcgatccttacggccctgtggccaatctggggtgcaagaaccacctt
gagcactttctcaatgtctatcactggatgccgatcccggaaaagatggacttgctcact
ggcgatgcacgggcgcaactgaagggggaccgcgcgacgctggcggctttcgacgaggcg
ttttcggacaccgaggagtgcgatccccacgacagggtgctgcacgcctttcagaagatc
cacctcggctgcgtgctcgacaaggtggataccatcggcatgctcgcatcgctggagggg
cgcgtaccgttcgtcgaccacgaactggtcgagaccttcatacacatgccgcatgcgttg
aagatgaagtggcgctctcccatgtcactgcttcgcgcgctcggcacgtcggcattcaag
gcgtccgaagtgctggatcagaacaagtacctgctgcgcaagcacggtcagtcgctgctc
ccggggcacctcgcgcaccgcaagaagatggggtttccgacgccccttgatgactggatg
aagtcggggatgctggacgacgcgcgggccctgctgctggatcagcgttcgcgcgaacgc
ggtatcttcgacccgaagcggctggagcatttcctgggcaacccgcagtcgctggattac
gacttctacggaaagaaggtgtggatgctcatgaacctggagttgtggttccggcgggtg
gtggacagccaggtgcaggagcccagtgtcacggcttcccggctggaagccccggcgatg
gtggcgtag

DBGET integrated database retrieval system