KEGG   Acidovorax avenae: Acav_2142Help
Entry
Acav_2142         CDS       T01445                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
  KO
K07486  
transposase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2391852..2392802
Genome map
AA seq 316 aa AA seqDB search
MSELVYVGIDIAKNSFEVAVTGELQTLNLANDEAGHAQLCQWLAPLAPRLILMEATGGYE
QDLALALAGAGLRVSVVNPRQARDFARCVGKLAKTDRIDAQALRSFASMLDAQGHQPRAL
ADDERRELTALVVRRRQLVTMLVSERQRLGVAHRKAKPSILAIMDAIAAQLHDVDDELKA
HVQTHHADLAKLLTSVKGVGPTTACTLLAQLPELGQLNRKQITALVGLAPMNRDSGTLRG
QRHIFGGRADVRRVLYVAALVGTRFNPVLKAFYAKLLAAGKAKKVALVACMHKLLVILNA
IARTRSPWRDDFAERL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactcgtctacgtgggcatcgatatcgccaagaacagcttcgaagtggctgtc
acgggcgaactgcagacgctcaatctggccaacgacgaagccggccatgcccagctgtgc
caatggctcgcaccgctggcgcccaggctcatcctgatggaggccaccggcggctatgag
caagacctcgcgctggccttggcgggcgcgggcttgcgcgtgtcggtggtcaaccctcgc
caggcacgcgacttcgcgcgctgcgtgggcaagctggccaagaccgaccgcatcgacgcg
caagctctgcgcagctttgcctcgatgctcgatgcgcaaggccaccagcctcgtgccctg
gccgacgacgagcgccgcgagctcacggccctggtggtgcgccgcaggcaactggtgacc
atgctggtgtccgagcgccagcgcctgggcgtggcccaccgcaaggccaagcccagcatc
ctggcgatcatggatgccatcgcggcgcaattgcacgatgtcgatgacgagctcaaggcg
catgtccagactcaccacgccgacctggccaaactgctgacctcggtcaagggcgtgggg
ccgacgaccgcctgcacgttgctggcgcaacttcccgaactcggccagctcaatcgcaag
cagatcacggccctggtcggtctggcgcccatgaaccgagactcgggcacgctcaggggc
cagcgccacatcttcggtggccgcgccgacgtgcggcgcgtgctctacgtcgcagccttg
gtcggcacgcgcttcaaccccgtcctcaaggcgttctacgccaagctgctggccgcgggc
aaagccaagaaggtcgccctcgtggcctgcatgcacaagctgttggtcatcctgaacgcg
atcgctcgcaccaggtcgccctggcgcgatgactttgctgagcgtctttga

DBGET integrated database retrieval system