KEGG   Acidovorax avenae: Acav_2151Help
Entry
Acav_2151         CDS       T01445                                 

Definition
(GenBank) amidohydrolase 2
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2400770..2401672
Genome map
AA seq 300 aa AA seqDB search
MNLPELSEPVPHSAGVKRPSHVLPALACDSHMHIFDRRFAPSPHWPRTPPDAPVAAYRQL
QQRLGTSRAVVVTPSTYGTDNACTLDALDQLGDGARGVAVVGQGVSDADLARLAARRVRG
LRVNFVSPQSWGETTPGMLAGLARQVACHPHCVGWHIQVFAQPEQIVAMEPLLQSLPVPL
VIDHLGRIDPAEGTAAPAYTVLRRLLDAGNTWVKLSGAYMRSAVHGPGYGDTLPLGRAFV
QAAPQRLVWGSDWPHTTEAPGSVDDAALVDLLRAWTGSDAAMDAILVDNPARLYGFGVQA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcccgaactttctgaacccgtgccccattcggcgggggtgaaacggccatcg
cacgtgctgcccgcgctggcctgcgacagccacatgcacatcttcgaccggcgcttcgcg
ccgtcgccgcactggccgcgcacgccgcccgatgcgccggtggctgcctaccgtcaactg
cagcagcgactgggcacgtcgcgcgcggtggtggtcacgccgtccacctacggcaccgac
aacgcctgcacgctcgacgcactggaccagctgggcgatggcgcgcggggcgtggccgtg
gtcgggcagggagtttccgatgccgacctggcccgcctggctgcgcgccgggtgcggggg
ctgcgcgtcaatttcgtctccccgcagtcctggggcgagaccacgcccggcatgctggcc
ggcctggcgcggcaggtggcctgccatccccactgcgtgggctggcacatccaggtgttc
gcgcagccggagcagatcgtcgcgatggagcccctcctgcagtccttgcccgtgccgctg
gtcatcgatcacctggggcgcatcgatccggcagaaggcaccgcggccccggcatacacc
gtactgcgccggctgctggacgccggcaatacctgggtcaaactgtcgggcgcctacatg
cgctccgcggtgcacggcccggggtacggcgatacgctccccctgggccgcgcattcgtg
caggccgcaccgcagcggctggtgtggggcagcgactggccgcacaccaccgaagcgccc
ggtagcgtggacgatgcggcgctggtggacctgctgcgggcctggaccggctcggacgcc
gccatggatgccatcctggtggacaaccccgcgcggctctacggcttcggcgttcaggcc
tga

DBGET integrated database retrieval system