KEGG   Acidovorax avenae: Acav_2152Help
Entry
Acav_2152         CDS       T01445                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region-containing protein
  KO
K01053  
gluconolactonase [EC:3.1.1.17]
Organism
aaa  Acidovorax avenae
Pathway
Pentose phosphate pathway
Ascorbate and aldarate metabolism
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acav_2152
   00053 Ascorbate and aldarate metabolism
    Acav_2152
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Acav_2152
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.17  gluconolactonase
     Acav_2152
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Acav_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2401738..2402667
Genome map
AA seq 309 aa AA seqDB search
MFLLQAPQIRDLETFTAMPASLRRPERSDWADANRGGTVTDSFLEGPVFDDAGHLYVSDI
PWGRIFRIDPQGAWSLVAEYDGEPNGMKFLDAGTLLITDYKNGLMRLDVATGRVSPYLQR
RNSERFKGVNDLVFDAEGNLYFTDQGQSGLHDPSGRLYRLRTNGQLDLLLHNVPSPNGVA
LSPDGRVLYLAVTRGNCVWRVPLLPDGSVAKVSQFFTSYGPSGPDGLAVDRQGRVLVANP
GLGVVWILNGRAEPEWVLRGIPGSSTTNLAFGGEDRRTLYVTDSTHGRILRTTMESPGLP
LHRAIAGPR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgctgcaagccccccagatccgtgacctggaaaccttcacggccatgcccgca
tccctgcgccgccccgagcgcagcgactgggccgacgccaatcgcggcggcaccgtcacc
gactcgttcctcgaaggtccggtgttcgacgacgcgggccacctgtatgtgagcgacatc
ccctggggccgcatcttccgcatcgacccgcagggcgcctggagcctcgtggccgaatac
gacggcgagcccaacggcatgaagttcctcgatgccggcacgctgctcatcaccgactac
aagaacggactgatgcgcctcgacgtcgccaccggccgtgtgtcgccgtacctgcagcgc
cgcaacagcgagcgcttcaagggcgtgaacgacctggtcttcgatgcggaaggcaatctc
tacttcaccgaccaggggcagagcgggctgcatgatccttccgggcgcctctaccgcctg
cgcaccaacggccagctcgatctgctgctgcacaacgtgcccagtcccaacggcgttgcg
ctctcgcccgacggccgcgtgctgtacctggcggtcacgcgcggcaactgcgtctggcgc
gttccgctgctgcccgacggcagcgtggccaaggtgagccagttcttcacgtcctacggc
cccagcggcccggatggcctcgccgtggacaggcagggtcgggtgctcgtcgcgaacccg
ggcctgggcgtggtgtggatactcaacgggcgtgccgaacccgaatgggtgctgcgcggc
attcccggcagctccaccaccaaccttgccttcggcggcgaggaccggcgcacgctctac
gtgacggattccacgcacggccgcatcctgcgcaccaccatggagtcgcccggcttgccg
ctgcaccgggcgatcgccggaccgcgctga

DBGET integrated database retrieval system