KEGG   Acidovorax avenae: Acav_2155Help
Entry
Acav_2155         CDS       T01445                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
aaa  Acidovorax avenae
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Acav_2155
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     Acav_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2406863..2408143
Genome map
AA seq 426 aa AA seqDB search
MHSDIVIVGGGAGGLELAARLGRSLGAKQGRERVLLVDRSPFHIWKPTLHEVAAGTLDAH
QEGLSYPVLARRNHFGFAIGDLVGLDTARKTIELGEIRNAEGELLVPRRTVSYTRLVLAI
GSGSNAFGTPGIEHAYLLENVRDAQRFHTDWLGACARASFSESRALSIAIVGAGATGVEL
SAELLEAYAELLESLGSSQRFRLDITLVEGGSRILGGLPEKISAQAEVALRRKQVQVLTG
TRVTEIRRGALVTPNGEIPADMVVWAAGIKAAEGNARLGLEVNRLNQFIVDDRLRTSAPD
VLAFGDCAACPWVDGKTVPARAQAAHQQADYLAKVLGALLREQEVAAPFVYKDFGSLVSL
GDNKGVGNLMGGLGGRNFFVEGLIAKWMYISLHLNHHRAILGTGKTVVLALARLLQQRVS
GRLKLH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgacatcgtgatcgtgggcggcggggccggcgggctggaactggcagcgcgc
ctcgggcgcagcctcggtgcgaagcagggccgcgaacgcgtgctgctggtggaccgttcg
cctttccacatctggaagcccaccctgcacgaggtggccgccggcacgctggacgcccac
caggaaggactgtcctaccccgtgctggcacggcgcaaccatttcggcttcgccatcggc
gacctggtggggctggacacggcgcgcaagaccatcgagctgggcgagatccgcaacgcc
gagggcgagctgctggtgccgcgccgcacggtgagctacacccgcctggtgctggccatc
ggcagtggctccaacgctttcggcacgcccggcatcgagcatgcctacctgctcgagaac
gtgcgcgatgcgcagcgcttccataccgactggctgggcgcctgcgcgcgggcctcgttt
tccgaaagccgggcactgtcgatcgccatcgtgggcgcgggcgcgacgggcgtggagctg
tccgcggaattgctggaagcctatgccgaactgctcgaaagcctgggcagcagccagcgc
tttcgcctggacatcaccctggtcgaaggtggcagccgcatcctgggcggcctgcccgag
aagatttccgcgcaggccgaagtggcgctgcggcgcaagcaggtgcaggtgctcaccggc
acgcgcgtgaccgagatccgccgtggcgccctggtcacccccaacggagagattcctgcg
gacatggtggtctgggccgccggcatcaaggcggcggagggcaatgcccgcctgggcctg
gaggtgaaccggctcaaccagttcatcgtggacgaccgcctgcgtacctcggcgcccgac
gtgctggccttcggcgactgcgccgcctgcccgtgggtcgatggcaagaccgtgcccgcc
cgcgcgcaggccgcgcaccagcaggccgactacctggccaaggtgctgggcgcgctgctg
cgcgagcaggaagtggccgcgcccttcgtgtacaaggatttcggctccctggtctcgctg
ggcgacaacaagggcgtgggcaacctcatgggcgggctcggcgggcgcaacttcttcgtc
gaaggcctgatcgccaagtggatgtacatctccctgcacctgaaccaccaccgcgccatc
ctgggcaccggcaagacggtggtgctggccctggcacggctgctgcagcagcgcgtgtcc
ggccggctcaagctgcattga

DBGET integrated database retrieval system