KEGG   Acidovorax avenae: Acav_2160Help
Entry
Acav_2160         CDS       T01445                                 

Definition
(GenBank) CheW protein
  KO
K03408  
purine-binding chemotaxis protein CheW
Organism
aaa  Acidovorax avenae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Acav_2160
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Acav_2160
Bacterial motility proteins [BR:aaa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Acav_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2411464..2411973
Genome map
AA seq 169 aa AA seqDB search
MLSTPSAAQHRSGAQAATPPAEYLTFRLGQEEYGIDILRVQEIRSYEQPTRMAHAPEFIK
GVIDLRGVIVPIVDLRLKLNCAQAEYTDFTVVIILNVGGTVLGAVVDAVADVVELSAEAI
RPAPQFQGQVDSAFVTGIATLGERMLIVMDIESLLSSSEMGLVRSVAAN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaccccttctgccgcccagcaccgctcgggagcccaagccgccactcctccc
gcggagtacctgaccttccgcctgggccaggaggaatacggcatcgacatcctgcgcgtg
caggaaatccgctcctacgagcagccgacgcgcatggcgcatgcgccggaattcatcaag
ggcgtgatcgacctgcgcggcgtgatcgttcccatcgtggacctgcgcctgaagctcaac
tgcgcgcaggccgagtacaccgacttcaccgtcgtcatcatcctgaacgtcggcgggacg
gtcctgggcgcggtggtggatgcagtggcggacgtggtggaactctccgccgaggcgatc
cgtcccgctccgcagttccagggccaggtggattccgccttcgtcaccggcatcgccacg
ctgggcgagcgcatgctgatcgtcatggacatcgaatcgctgctgagcagctccgagatg
ggcctcgtgcgctccgtcgcggccaactga

DBGET integrated database retrieval system