KEGG   Acidovorax avenae: Acav_2165Help
Entry
Acav_2165         CDS       T01445                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00901  
diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
aaa  Acidovorax avenae
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acav_2165
   00564 Glycerophospholipid metabolism
    Acav_2165
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     Acav_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2416246..2416638)
Genome map
AA seq 130 aa AA seqDB search
MNAPIFDNPHKARRGLGRIWHAAIHSCHGLQAGWSEKAFRLEAILACILLPLAFWIARSW
VEAALLCGSVVLVLITELLNSAVEAAIDRIGPEWHALSKRAKDMGSAAVLLGLVFCAAVW
AAALFQRFYG
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccgattttcgacaatccccacaaggcccggcgtgggctcggccggatctgg
cacgcggccatccattcctgccacggcctgcaggccggctggtccgagaaggctttccgg
ctcgaggccatcctggcgtgcatcctgcttccgctggcgttctggatcgcgcgcagctgg
gtggaggcagcgctgctgtgcggcagcgtggtgctcgtgctgatcacggagctgctgaat
tccgccgtcgaggccgcgatcgaccgcatcgggccggaatggcatgcgctgtccaagcgc
gccaaggacatgggcagcgccgccgtgctgctgggcctggtcttctgtgccgcggtatgg
gccgcggcgttgttccagaggttctacggatga

DBGET integrated database retrieval system