KEGG   Acidovorax avenae: Acav_2174Help
Entry
Acav_2174         CDS       T01445                                 

Definition
(GenBank) CDP-diacylglycerol/serine O-phosphatidyltransferase
  KO
K17103  
CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
aaa  Acidovorax avenae
Pathway
Glycine, serine and threonine metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Acav_2174
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_2174
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     Acav_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2423222..2424055
Genome map
AA seq 277 aa AA seqDB search
MHDGKDAAATPGVMTRKRRKGIYILPNLFTLAALFGGFYAVVMAMNGRFDLAAVGVFCAM
VLDSLDGRVARMTNTQSAFGEQMDSLSDMVSFGAAPALIAYEWALKGLGRWGWIAAFVYC
ACAALRLARFNVNTGVVDKRYFQGLPSPAAAALVAGFIWLMTELGVQRGADAWVAWGHIC
WLMFGVTLYAGLTMVTNVPFYSFKDIQMKRSVPFATIVLIALGIAVVNIHPPTVLFGVFV
LYGLSGYGVYAWRKAKGQHSSVISISTDEPDERGLHK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatggcaaggacgccgcggccaccccgggcgtgatgacgcgcaagcgccgcaag
ggcatctacatcctgcccaatctcttcacgctggcagcgctgttcggcggcttctatgcc
gtcgtgatggccatgaacggccgtttcgacctcgctgcggtcggcgtgttctgcgcgatg
gtgctcgacagcctcgacggccgcgtggcccgcatgaccaacacccagagcgccttcggc
gagcagatggattcgctgtccgacatggtgtcgttcggcgcggctcccgcgctcatcgcc
tacgaatgggcgctcaagggcctcggccgctggggctggatcgctgccttcgtctattgc
gcatgcgcggcgctgcggctcgcccgcttcaacgtcaacaccggcgtggtggacaagcgg
tacttccaggggctgccgtccccggcggccgcggccctggtggcgggtttcatctggctg
atgacggagctgggcgtgcagcgcggggcggatgcctgggtggcctggggccacatctgc
tggctgatgttcggcgtcaccctgtacgccggcctcaccatggtgaccaacgtgccgttc
tacagcttcaaggacatccagatgaagcgcagcgtgccgttcgccaccatcgtgctgatc
gcgctgggcatcgcggtggtgaacatccatccgcccacggtgctcttcggcgtcttcgtg
ctctacggactgagcggctacggcgtctatgcctggcgcaaggccaagggacagcacagc
agcgtcatcagcatctccacggacgagcccgacgagcgcggcctgcacaagtga

DBGET integrated database retrieval system