KEGG   Acidovorax avenae: Acav_2183Help
Entry
Acav_2183         CDS       T01445                                 

Definition
(GenBank) methionine aminopeptidase, type I
  KO
K01265  
methionyl aminopeptidase [EC:3.4.11.18]
Organism
aaa  Acidovorax avenae
Brite
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     Acav_2183
Peptidases [BR:aaa01002]
 Metallo Peptidases
  Family M24
   Acav_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2433724..2434539)
Genome map
AA seq 271 aa AA seqDB search
MSITIKSAEEIAGMREACRLASEVLDHITPHIRPGITTNDVDRLAAECMAAQGTISATIG
YQPPGYPPYPKSLCTSLNHVVCHGIPNDKPLKKGDIMNVDVTVITKDGWYGDNSRMYLIG
DVSIAAKRLCQLTFEAMWLGILQVKPGAHLGDIGHAIQKFAEGHGLSVVREFCGHGIGKK
FHEEPQVLHYGRPGTLEELVPGMTFTIEPMLNAGRREVKEHGNDGWTIVTKDHSLSAQWE
HTVLVTETGYEVLTLSAGSPPLPPFVTAVKT
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaccatcaagtccgccgaggaaatcgccggcatgcgcgaagcctgccgcctg
gcttcggaagtgctggaccacatcacgccccatatccgtcccggcatcaccacgaacgac
gtggatcggctcgccgccgagtgcatggccgcacagggcaccatctcggccaccatcggc
taccagccgccgggctacccgccctaccccaagtcgctctgcacctcgctcaaccacgtg
gtctgccacgggattccgaacgacaagcccctcaagaagggcgacatcatgaatgtggac
gtcaccgtcatcaccaaggacggctggtacggcgacaacagccgcatgtacctgatcggc
gatgtctccatcgccgcgaagcgcctgtgccagctcaccttcgaggcgatgtggctgggc
atcctgcaggtgaaaccgggggcgcacctgggcgacatcggccatgccatccagaagttc
gcagaaggccacggcctgtcggtggtgcgcgagttctgcggccacggcatcggcaagaaa
ttccacgaagaaccccaggtgctgcactacggccgccccggcacgctcgaggaactggtg
ccgggcatgaccttcaccatcgagcccatgctcaacgccggccgccgcgaggtcaaggag
cacggcaacgacggctggaccatcgtcaccaaggaccacagcctgtcagcccagtgggag
cacacggtgctcgtgaccgagacgggctatgaggtcctcaccctgtcggccggctcgccg
ccgctgccgccgttcgtcacggccgtgaagacctga

DBGET integrated database retrieval system