KEGG   Acidovorax avenae: Acav_2190Help
Entry
Acav_2190         CDS       T01445                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2443797..2445584)
Genome map
AA seq 595 aa AA seqDB search
MSEPSSHRVLEHLPAVPAHTAQGGRRLRALVIGTLLLALTATWALVAISLQTKWQDAVQS
QRRQNANLARVLEEQTLRVLAAADQATLRVAAEVRSGEFTKEDYALFANETGLAPDILTQ
LSIVGPDGRFVGSNLDPTGARNQDTDLSEREHIRVHLEPSKVPHARTQMSASGLFIGKPV
TGRISGRRTMQLSRPIIGRNGYLHGVVVASLNPSYFEKVYGGVDIGAQGAVVLMGADFGM
LTRVIGTQAGNIDQVIEFPPDHPLADTTRRHGTYQRVSHVDGLGRITAFHRLPGYPLTVL
VSTADDEALAEWKTMRNFTMVFAGLFSAALVALCAGFLRGLRQLEQKNVALAASEAQARS
ANRAKSEFLTAISHELRTPLTSIHGFAELMEQRLEQPSYREAAGLIRSAAEHLNTLLSEI
LDLAKVQAGAMPIVPGDHAVRELVGTTVDLFAISAAQKGLTLEKRIAPDVPHMLRCDGLR
LKQILNNLLSNALKFTREGGVRLEVDTAEARNLRFRVIDTGPGIPADLHEVIFEKFSQGG
AEVSTQHGGTGLGLALSRGLAELMGGRLTVASETGHGACFTLELPMPAQEPPPAA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaccctcctcccaccgggtcctagagcacctgccggcagtgcctgcgcacacg
gcccagggcgggcggcggctgcgcgccctggtgatcggcaccctgctcctggcgctcacg
gccacctgggcgcttgtcgccatctcgctgcagaccaaatggcaggatgcagtgcaatcc
cagcgacgccagaatgccaacctggcccgcgtgctggaagagcagacgctgcgggtcctg
gcggcggccgaccaggccacgctgcgcgtggcggcggaagtgcgcagcggagagttcacg
aaggaggactacgccctgttcgccaacgagacaggcctggcgccggacatcctcacccag
ctgtccatcgtgggccccgacggccggttcgtgggcagcaacctcgaccccaccggggcc
cgcaaccaggataccgacctgagcgagcgcgaacacatccgggtgcacctggagccctcc
aaggtaccccacgcgcggacgcagatgtccgcatccggcctcttcatcggcaagcccgtc
acgggccggatctcgggccgccggaccatgcagctgagccggcccatcatcggccgcaac
ggctacctgcacggcgtggtggtcgcctcgctcaatccgagctatttcgagaaggtgtac
ggtggcgtggacatcggcgcccagggcgcggtcgtgctgatgggggcagacttcggcatg
ctgacccgggtgatcggaacccaggcaggcaacatcgaccaggtcatcgaattcccgccc
gaccatcccctcgcggacaccacccgcaggcatggcacctaccagcgcgtcagccacgtt
gacgggctgggccgcatcaccgccttccaccgcctgcccggctatccgctgaccgtcctc
gtgtccacggccgacgacgaagccctggcggaatggaagaccatgcggaacttcaccatg
gtgttcgccgggctcttttccgcagcactggtcgccctgtgcgcgggcttcctgcgggga
ctgcgccagctcgagcagaagaacgtggcactcgcggcgagcgaagcccaggcccgctcc
gccaaccgcgccaagagcgaattcctgacggccatttcgcacgaactgcgcacccctctc
accagcatccacggttttgcggagctcatggaacagcggctggagcagccgtcctaccgc
gaagccgccggcctgatccgcagtgcggcggagcacctcaacaccctgctgtccgagatc
ctggaccttgcgaaggtgcaggccggcgccatgcccatcgtgcccggagaccatgccgtg
cgcgaactcgtcggcactaccgtggacctcttcgccatctctgccgcgcagaaagggctc
acgctcgaaaagcgcatcgccccggacgtaccccacatgctgcggtgcgacggactgcgg
ctcaagcagatcctcaacaacctgctgagcaacgcactcaagttcacccgggagggcggc
gtgcggctggaggtggacaccgccgaggcgcgcaacctgcgcttcagggtcatcgatacg
ggccccggcatccccgccgacctgcacgaggtcatcttcgagaaattcagccagggcggt
gcggaggtgagcacccagcacggtggcacgggcctgggcctggcgctttcgcgcgggctc
gccgagctcatgggcggccggctcaccgtggcctccgaaaccggccatggcgcctgcttc
acgctggaactccccatgcctgcgcaggagcctccacccgcggcctga

DBGET integrated database retrieval system