KEGG   Acidovorax avenae: Acav_2206Help
Entry
Acav_2206         CDS       T01445                                 

Definition
(GenBank) aminoglycoside phosphotransferase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2463762..2464847)
Genome map
AA seq 361 aa AA seqDB search
MPSYEHFTGTRPVSEQHAFDTDALSAWMAEHVEGFEGPLAVEMFKGGQSNPTFKLNTPAR
SYVMRAKPGPVAKLLPSAHAVEREFQVMGGLAGTGVPVPRMFALCEDESVIGRAFYIMEF
LQGRVMWDQALPDMDPAGRGAIYDEMNRVIAALHTVPFAERGLAGYGKPGNYFERQIGRW
SKQYVASITQPIEAMDRLMEWLPAHMPASARDESRVSIVHGDFRLDNLMFHPTEPHVIAV
LDWELSTLGHPLADFSYHCMAWHIPPGMFRGIGGLDHAALGIPTEDEYIRRYCERTGFGT
PEALRADWNFYLAYNLFRLASILQGIAKRVEDGTASSAQARASGEGARPLAEMAWGFAQR
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccctcttacgaacacttcaccggcacccgccccgtttccgagcagcatgcattcgac
acggatgccctctcggcctggatggcggagcatgtggaaggcttcgagggcccgctggcg
gtggagatgttcaagggcgggcagtccaaccccaccttcaagctgaacacgcccgcgcgc
agctacgtgatgcgcgccaagcccggcccggtggcgaaactgctgccctcggcccatgcc
gtggagcgcgagttccaggtgatgggcgggctggccggcaccggcgtgccggtgccgcgc
atgttcgcgctgtgcgaggacgaatccgtgatcgggcgcgccttctacatcatggagttc
ctgcagggccgcgtgatgtgggaccaggccctgccggacatggaccctgccgggcgcggg
gccatctacgacgagatgaaccgcgtgatcgcggccctgcacaccgtgcccttcgccgag
cgcggcctcgcgggctacggcaagccgggcaactacttcgagcggcagatcggccgctgg
agcaaacagtacgtggcctccatcacgcagcccatcgaggccatggaccggctcatggag
tggctgccggcccacatgcccgccagcgcgcgcgacgaaagccgcgtctccatcgtgcac
ggcgacttccggctcgacaacctgatgttccaccccaccgagccgcacgtgatcgccgtg
ctcgactgggagctctccaccctcgggcacccgctcgcggatttcagctaccactgcatg
gcctggcacatcccgcccggcatgttccgcggcatcggcggcctggaccacgccgcgctg
ggcatccccaccgaagacgaatacatccgccgctactgcgagcgcaccggcttcggcacg
cccgaagcgctgcgcgcggactggaacttctacctcgcctacaacctgttccgcctcgcc
tccatcctgcagggcatcgccaagcgcgtggaggacggcaccgcgtccagcgcccaggcg
cgcgcctcgggcgaaggcgcccggcccctggccgagatggcctggggattcgcgcagcgc
atgtag

DBGET integrated database retrieval system