KEGG   Acidovorax avenae: Acav_2209Help
Entry
Acav_2209         CDS       T01445                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  
3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
aaa  Acidovorax avenae
Pathway
Phenylalanine metabolism
Benzoate degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Acav_2209
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Acav_2209
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acav_2209
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     Acav_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2466604..2468124)
Genome map
AA seq 506 aa AA seqDB search
MTNPFPIVGIIGTGAMGQGIAQMAAQAGSQVLLLDNRPGAADTAQRNIQQQWERLAAKGR
ISGDEAAALAGRLAPAAALQDLAGCHLIIEAIVERLDAKQALFSELERIVPQAAVLATNT
SSLSVTAIGAALKHPERLAGFHFFNPVPLMKVVEVIAGLKTDPAVCDRLSGLARAMGHTP
VRAQDTPGFIVNHAGRGFGTEALRIVSEGVADFATVDRILRDQVGFRLGPFELMDLTALD
VSQPVMESVYRQYYEEPRYRPSALAAQRLAAGLLGRKTGEGFYRYVDGQAQVPAEPPVPT
VAEIPPVWVSSRAARRAEVFQLLKDLGARIETGTSPSPQAISLVAPLGFDITTVAVVERL
DPARTIGIDMLVEDAATRRRVLATNPATRVDIRDAAHALFARDGKAVSVIRDSGGFVTQR
VVATIVNIASDICQQGICSPADLESAVTLGLGYPLGPLAMGNRWGPANMLEVLFNLQTVY
GDPRYRPSPWLRRRGAIGLSLLHEEA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccccttccctatcgtaggcatcataggcacgggcgccatgggccagggcatc
gcccagatggcggcgcaggccggcagccaggtgctgctgctcgacaaccggccgggcgcg
gccgacaccgcgcaacgcaacatccagcagcagtgggaacgcctcgccgccaagggccgc
atctccggcgacgaggccgcggcgctggccggccggctggctccggccgctgcgctgcag
gatctcgccgggtgccacctcatcatagaagcgatcgtggagcgcctggacgccaaacag
gcgctttttagcgaactcgaacgcatcgtcccgcaggcggcggtgcttgccaccaacact
tcctcgctgtccgtgacggccatcggcgcggcgctgaagcatccggaacgcctggcgggc
ttccatttcttcaaccccgtcccgctcatgaaggtggtggaggtcatcgccggcctgaag
accgacccggcggtgtgcgaccggctctccggactcgcccgcgccatgggccacaccccg
gtacgcgcgcaggacacgcccggattcatcgtcaaccacgccgggcgcggcttcggcacg
gaagcgctgcgcatcgtcagcgagggcgtggccgacttcgccacggtggaccgcatcctg
cgcgaccaggtcgggttccgcctgggcccgttcgagttgatggacctgaccgcgctcgac
gtctcgcagccggtcatggaatccgtttatcggcagtattacgaagagccgcggtaccgc
cccagcgccctggctgcgcagcggctggccgccgggctgctcggccgcaagaccggcgaa
ggcttctaccgctacgtggacggccaggcgcaggtaccggccgagccgcccgtgcccacg
gtcgcggagatcccgcccgtgtgggtgtcgtcgcgcgccgcgcggcgggccgaggtgttc
cagctgctcaaggacctgggcgcccggatcgagaccggcacgtccccgtcgccgcaggcg
atctccctcgtggcgccgctgggcttcgacattaccaccgtggccgtggtcgaacgcctg
gacccggcgcgcaccatcggcatcgacatgctggtggaggacgccgccacccgccgacgc
gtgctggccaccaaccccgccacgcgcgtcgacatccgcgatgccgcgcacgccctcttc
gcgcgcgacggcaaggccgtgagcgtgatccgcgacagcggcggtttcgtgacgcagcgc
gtggtggcgacgatcgtgaacatcgccagcgacatctgccagcagggcatctgcagtccc
gccgacctggaatcggccgtcacgctgggcctgggctatcccctggggccgctcgccatg
ggcaaccgctgggggccggcgaacatgctggaggtgctgttcaacctgcagacggtgtat
ggcgacccgcgctaccgccccagcccctggttgcgccgccgcggcgcgatcgggctgagc
ctgctccacgaagaggcctga

DBGET integrated database retrieval system