KEGG   Acidovorax avenae: Acav_2210Help
Entry
Acav_2210         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2468162..2470492
Genome map
AA seq 776 aa AA seqDB search
MCKNEPNKNATIVKISNAILGASLSALATGASALSLGASHGTVVLGAPVDLVFDVQPDPG
SDVESSCVRVRLLSGDTVVPDSKVQVTPVPATGGRNPAVRVRAFITADEPVVTAAVSAGC
SGGVTRRYTFLAQLPEAVAAASPSGPVDIGRLAGARASATGSAAGAATQGMGGRGPRAAA
SGAAPSSAPRASRPAAAAAPSSAPRPPSRALKPAPVAAASPAAERARLVMEPLDVWLDGP
LPLRQSAELAHAADTTSPEQRAQAAALWKALNTPVEDVQRAAGQVAQLEGSVATERARAA
SERAAAADLRQRLDSAESERFPAVLVYALAGLLVLLALLAAWLWGRARRASASAWTEAVA
ASSQPREPGGEPMAPDGSALATRPQADAPAVRPKRQPVMPSRASASAARVPPVAAEPTAP
VAVAAPVERPAFQLPAFADSLSGAVLVEGPVMTRNAPLAPEPAAAPAAPVPAPVVAPAPA
PVAAPVPAAMPRMAGPQPEDLFDIQQQAEFFVSVGEHDQAIAVLRQHIAAHGDTSAFAYL
ELLRLYHTLGRVEGFHQLREQFCAQFNVSVPEFGNFHRSGKTLQGYPDALAAIEAEWSSP
AVLGVIEGFLFRQADAPRAMQFDLAAFDDLLLLLAIAQTTPASARGPAPPRLRTTPNEIP
ADEVQAAAAPVRAASAEPEEELRSFDTLSAGLTWESLPAPLPRAPSTAPSPLHEDPDAML
DIDLSEPPHLTLSDLPPVPVTPPPAPGQSVGFGMDEKMELRLELDEFERKNRTPKG
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaagaatgaaccgaataagaatgcaactattgtgaagataagtaacgcgatactc
ggagcaagtctttccgccctggccacgggggcgtcggcgttgtcgctgggcgccagccat
ggcacggtggtgctgggtgcgccggtggacctcgtgttcgacgtgcagcccgatccgggc
agcgatgtcgagtcttcctgcgtgcgggtgcgcctcctgtccggcgatacggtcgtgccg
gactccaaggtgcaggtcaccccggttcctgccaccggcggccggaacccggccgtgcgc
gtgcgtgcattcatcacggcggacgagccggtcgtcaccgccgcggtttccgccggctgc
agcggcggcgtgacccgccgctacaccttcctcgcgcagctgcccgaagcggtggctgcg
gcgtcaccgtccggcccggtggatatcggcaggctggccggagcgagggcttccgccaca
ggttcggcggctggtgctgctacccagggcatgggcgggcggggccctcgggccgccgcc
tccggtgccgcgccttcctccgcgccgcgcgccagccgcccggctgctgcggcggcgcct
tcctctgcaccccggccgccgagccgcgcgctgaaaccggcacccgtggccgccgcatcg
cccgcggccgagcgtgcccggctggtgatggaacccctggatgtctggctggacggcccg
ctgccgctgcgccagtcggccgaactggcccacgccgcggacaccacctcccccgagcag
cgcgcgcaggccgcggcgctgtggaaggcgctcaacacccccgtggaagatgtgcagcgc
gcggccggccaggtcgcgcagctcgaagggagcgtggcgaccgagcgcgcccgcgccgca
tccgagcgcgccgcggcggccgacctgcggcaacggctggacagcgccgagtccgagcgc
ttcccggccgtcctggtctatgcgctggcgggcctgctggtgctgctggccttgctggcc
gcctggctgtggggccgcgcccgcagggcatcggcctccgcctggaccgaggccgtcgcg
gccagcagccagccccgggagcccggcggcgagccgatggcgccggacggctccgcgctg
gcgacccggccgcaggcggatgcacccgcggtccgcccgaagcgtcagcccgtgatgccc
agccgggcgtcggcctccgcggccagggtgcctccggtggcggccgagccgacggctccc
gtggcggttgccgccccggtcgagcggcccgccttccagcttcccgcgttcgcggactcc
ctgtccggcgcggtgctggtcgagggaccggtgatgacgcgcaatgcgccgctggctccc
gagcccgcggccgcaccggctgcgccagttcctgcacccgtcgtggcgcctgcgcctgcc
ccggtggcggcgcccgtgcccgccgcgatgccccgcatggcaggcccgcagcccgaagac
ctgttcgacatccagcagcaggcggaattcttcgtgtcggtgggcgagcacgaccaggcc
atcgccgtgctcaggcagcacatcgccgcccacggggatacctcggcgttcgcctacctg
gaactgctgcggctctaccacacgctcggccgcgtggagggcttccaccagctgcgcgag
cagttctgtgcgcagttcaacgtctcggttcccgagttcggcaacttccatcgcagcggc
aagactctgcagggctaccccgacgccctggcggcgatcgaggccgaatggtcctcgccg
gccgtgctcggggtgatcgagggattcctgtttcgccaggccgacgcgcccagggccatg
cagttcgacctggcggccttcgacgacctgctgctgctgctggccatcgcacagaccacg
cccgccagcgcccgtggcccggcgccgccgcgcctgcgcaccacgccgaacgagatcccc
gccgacgaagtgcaggccgctgctgcgccggtccgtgccgccagcgccgagcccgaggag
gaactgcgttcgttcgacacgctctcggcgggcctgacctgggaatcactgcccgcgccg
ctgccccgggccccgtccaccgcgccgtctcccctgcacgaagacccggacgcgatgctc
gacatcgacctgtccgagccgccccacctcacgctcagcgacctgcctccggtgccggtg
acgccgccgcccgcgcccggccagtcggtgggcttcggtatggacgagaagatggaactg
cgcctggaactggacgagttcgagcgcaagaaccgcacgcccaagggctga

DBGET integrated database retrieval system