KEGG   Acidovorax avenae: Acav_2213Help
Entry
Acav_2213         CDS       T01445                                 

Definition
(GenBank) thiamine biosynthesis protein ThiS
  KO
K03154  
sulfur carrier protein
Organism
aaa  Acidovorax avenae
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Acav_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2472306..2472503)
Genome map
AA seq 65 aa AA seqDB search
MNVVINQKATELPEGATVAHAIAAIAARPPFAVAVNTVFVPQARHAGHALRPGDRVEIIA
PVTGG
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgtcatcaaccagaaagccaccgagctgcccgagggcgccaccgtggcccat
gccatcgcggcgatcgccgcccgcccgcctttcgcggtggccgtcaacaccgtgttcgtc
ccccaggcccgccatgccggccacgcgctgcgacccggcgaccgggtggagatcatcgcg
cccgtgacgggcggctga

DBGET integrated database retrieval system