KEGG   Acidovorax avenae: Acav_2216Help
Entry
Acav_2216         CDS       T01445                                 

Definition
(GenBank) adenylate/guanylate cyclase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2474789..2478724
Genome map
AA seq 1311 aa AA seqDB search
MSLRAPDPGHIREAFSAQDALVQRYVLQDVIGTGSYGIVFSAAHRQTAQKVVLKFVRIDE
DERLFKRFRREIAACARLHHPHIVQLLDEGVCGPFVFAVFEFVPGLTLRQLLQNQGALPA
AEAGRLMLQVLDAMACAHDAGITHRDLKPENIMISASGLTSHAKVLDFGISTLLPGFGDA
LATQLTREGEYVGTPAYSSPEQLRGEAVTPQADLYAWGLIFLECLTGKVVTGESTAEIYQ
RQLSPQEFSLPQAIQGHPLAEVLRSALRKRCQDRAASARQLWERSAAVRLDDLVGILRTR
PGAGPSAIAPTVAFGTPHEEKRQLTLLYCGVYFSDLPETADEEAAERQEMAQRSVLRRLI
DVAVQRGGTLGGTLGTHFLVTLGYSSHAEADARLAAQISRELVRSAEDAGPEVRWQVRIG
LHTGSVLIESGSVVPCRALDIAMRMEAAAADGQVVVSEAARQRLRHHARFVPQGGVRLPG
AASEIPSFGMLPEEAARQPLREAVGRWRELLALRRRWRDAAAGRGRAVLVRGEAGIGKSC
LSETFLSQVEGREGLVLRTACWPEQENSALAPMLALVRAQCGDPEAPDDAVVDRLSALLS
AAGCDVERVLPIFCVWLSLQVGRHQVVDIAPALQKALLMEAAQRWLQAQARSAPVLLFVE
DLHWADSATLEWLAALAGAMADQRWMLLLTARPEWEPALPMSGALQRLEVGRLGPAEAAS
MVRHVLAPRRVSQAVIDHVVARTDGVALFIQELARTLLETCLVERDGLWDFQEQADLKGI
PITLRDSLESRFMQLGPAREVLRWASIWGRRFDAEWLPDCGMQDVEDSLRSLVDVGLLMP
ADAAGHYLFRHALIRDAAYDSMLATQRSHMHGVVATVILKRRPRVRDEEPGLLAHHYALA
RDFANAVPAGLAQLRMTQHRSLNDETITYSRTVEEWIDRLDEPDRWEPRLALDGYVLQAL
MNKYGWAHPQVEQRIEQSRGLVERDISVDLRVQHIWLMLTYHHVASHRAEVMRLSLQLEE
LARRQGDAGILVAACTWIGLAFYSEGRFEEAERYLSEAIDERHADASRHHAAQLGFDTVS
WALAARSLVRWGAGHDALANEDGVRAVERARALAHIPSMGITMLYQALGYLGRQDVECAR
QVVDELIELSGRYGLPAFRGYAEVIRCWVAGDLAGADGMIEALWGIGCKYCQTYYRAFCA
EILARQGRWADAAGRLEHCIELTRELDEGIYTAELWLQKAHCLLQDGARAEEAAACLRQA
VQVAREGGKHRVEAQALSRLRHVDPASCTASDEERLQSLLGMRPELGAFVC
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccgcgctccggacccggggcacatccgggaagctttctccgcgcaggacgcg
ctcgtgcagcgctacgtgctgcaggacgtgatcggcacgggctcctacggcatcgtgttt
tccgcggcccatcgccagaccgcccagaaggtggtgctgaagttcgtccgcatcgacgag
gacgagcgccttttcaagcggttccggcgcgagatcgcggcctgcgcccggctccaccat
ccgcacatcgtgcagctgctcgacgagggcgtgtgcggaccgttcgttttcgcggtgttc
gagttcgtcccgggcctgacgttgcggcagttgctgcagaaccagggtgcgctgcccgcg
gccgaggccggccgcctcatgctccaggtgctggacgccatggcctgcgcgcacgatgcg
gggatcacgcaccgcgacctcaagcccgagaacatcatgatcagcgcttcggggctgacc
tcgcatgccaaggtgctggatttcggcatcagcacgctgctgcccggcttcggcgacgcc
ctggccacgcagctcacgcgcgagggtgaatacgtcggcacgcccgcctacagctcgccg
gagcaattgcgcggcgaagccgtgaccccccaggccgacctctatgcctggggactgatc
ttcctggagtgcctcaccggcaaggtggtcactggcgaatccaccgccgagatctaccag
cggcagctgtcgccccaggagttcagcctgccccaggcgatccagggccatccgctggcc
gaggtgctgcgcagcgccctgcgcaagcgctgccaggaccgggccgcctcggcgcgccag
ctctgggagcgctcggccgccgtgcgcctggacgacctggtgggcatcctgcgcacgcgc
cccggcgccggcccgagcgccatcgcgcccaccgtggccttcggcacgccgcacgaggaa
aagcggcaactgaccctgctgtactgcggcgtctatttctcggatttgcccgagacggcc
gacgaggaggccgcggaacggcaggagatggcccagcgcagcgtgctgcgccgcctcatc
gatgtcgccgtgcagcgcggcggcacgctgggcggcaccctggggacgcatttcctggtc
acgctcggctactcctcccacgccgaggccgatgcccgcctggccgcacagatctcccgc
gagctggtgcgctcggcagaggatgcgggcccggaggtgcgctggcaggtgcgcatcggc
ctgcacacgggttccgtcctgatcgaaagcggttcggtcgtgccgtgccgcgcgctggac
atcgccatgcggatggaggccgcggcagccgatggccaggtggtcgtgagcgaggcggcg
cgccagcgcctgcgccaccatgcgcgcttcgtgccgcagggcggcgtgcgcctgccgggc
gccgcctcggaaataccttccttcggcatgctgcccgaagaagccgcgcgccagccgctg
cgcgaagccgtgggccggtggcgcgagctgctggcgctgcgccgccgctggcgggacgcg
gccgccgggcgggggcgggcggtgctggtgcgcggcgaggccggcatcggcaaatcctgc
ctgagcgaaaccttcctgtcgcaggtggaggggcgcgaggggctggtcctgcgcacggcc
tgctggcccgagcaggagaacagcgccctggcacccatgctcgccctggtgcgcgcgcag
tgcggcgatccggaggctcccgacgacgccgtcgtcgatcgcctgtcggccctgctgtcc
gcggccggctgcgacgtggagcgcgtgctgccgatcttctgcgtctggctgtccctgcag
gtcggccggcaccaggtcgtggacatcgcccccgcgctgcagaaggcgctgctgatggag
gccgcgcagcgctggctgcaggcgcaggcgcgctccgcgccggtgctgctgttcgtcgag
gacctgcactgggcggattccgccacgctggaatggctggcggcgctcgcgggcgccatg
gcggaccagcggtggatgctgctgctcacggcccggcccgaatgggagccggccctgccc
atgtccggcgcgctgcagcggctggaagtgggacgcctggggccggccgaggccgcgtcc
atggtgcggcacgtgctggcgccgcgccgggtgtcgcaggcggtcatcgaccacgtggtc
gcccgtaccgatggcgtcgcgctgttcatccaggagctggcgcgcacgctgctggaaacc
tgcctggtcgagcgggacggcctgtgggacttccaggagcaggccgacctgaagggcatc
ccgatcaccctgcgcgactcgctggaaagccgcttcatgcaactgggcccggcacgcgag
gtgctgcgctgggcttccatctgggggaggcggttcgatgccgaatggctgccggactgc
ggcatgcaggacgtggaggacagcctgcggtccctggtggacgtggggctgctcatgccg
gcggatgccgcgggccactacctgttccggcatgcactgatccgcgacgccgcctacgac
agcatgctggccacgcagcgctcgcacatgcacggcgtggtcgccacggtgatattgaag
cggcgcccgcgcgtgcgcgacgaagagcccggcctgctggcgcaccactatgcgctggcc
cgggatttcgcgaacgcggttccggcggggctcgcccagctgcgcatgacgcagcaccgc
tcgctgaacgacgagaccatcacctactcgcgcacggtggaagagtggatcgaccgcctg
gacgagcccgaccgctgggaaccccggctcgcgctggatggctacgtgctgcaggcgctg
atgaacaagtacggttgggcgcacccccaggtcgagcagcgcatcgagcagtcccggggg
ctggtggaacgcgacatctcggtggacctgcgcgtgcagcatatctggctcatgctcacc
taccaccacgtggcgagccaccgcgccgaggtcatgcgcctgagcctgcagctggaagag
ctggcgcgccggcagggggatgcgggcatcctggtggcggcctgcacctggatcgggctg
gcgttctattccgaaggccgcttcgaggaggcggagcgctacctttccgaagccatcgac
gagcgccatgcagatgcgtctaggcaccacgccgcgcagctcggcttcgacaccgtatcg
tgggcgctggccgcgcggtccctggtccgctggggcgccggccacgacgcactggcgaac
gaggatggcgtgcgtgcggtggagcgcgcccgggccctcgcgcacattccctcgatgggg
atcaccatgctctaccaggcgctgggctacctgggccggcaggacgtcgagtgcgcccgc
caggtggtcgatgagttgatcgagctgtccgggcgctatggtctgccggccttccgcggg
tatgccgaggtcatccgctgctgggtggcgggcgacctggccggcgccgacggaatgatc
gaggccctctggggtatcggttgcaagtactgccagacctactaccgggccttctgcgcg
gagatcctggcgcggcagggccgctgggccgacgccgccggccggctggaacactgcatc
gaactcacccgcgaactggacgagggcatatacactgcggaattgtggctgcagaaggcc
cactgcctgctgcaggacggtgcgcgcgccgaagaggccgccgcctgcctgcgccaggcc
gttcaggtcgcccgggagggcggcaaacaccgggtagaggcacaggcgctgtcacgcctg
cgccatgtggatcccgcatcctgcactgccagcgatgaagagcggttgcagtccttgctg
ggtatgcgccccgagctcggggctttcgtgtgttga

DBGET integrated database retrieval system