KEGG   Acidovorax avenae: Acav_2218Help
Entry
Acav_2218         CDS       T01445                                 

Definition
(GenBank) polyketide biosynthesis O-methyltransferase-like protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2479556..2480410
Genome map
AA seq 284 aa AA seqDB search
MPAEGAAGLAGAWEALRGSSATLALTLSARASPLAREADAAWVDPWAAPLLALCPWDLRR
AADDSALVRAVVVRSLAFDRMVLQACSERPVHAVASLGVGLCTRQGRLAPSLPGVEWIDA
DLPEVIALRRLLLPAVAAACPGQLVPGALQDSAWLDAMPWQDGRHFLVLLEGVAPYVPPA
DIRHLLERLAARARREGCGCRVVLDYLHPDFVPIAAWQAGPAMLPVVSGFRDAAALVEGS
TGFRVLQECQTFGLFSEAHRRFEDEFRGRHGHVPYAVACLESAS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgccagctgaaggggcggccggcctcgccggggcctgggaggccctgcgcggcagttcc
gccaccctggcgctcaccctgagcgcgcgggcgtccccgctggcacgcgaggccgatgcc
gcatgggtggatccctgggccgcgccgctgctggcgctgtgcccctgggacctgcgccgc
gcggcggatgactccgcgctggtgcgggccgtggtggtgcgcagcctggccttcgaccgc
atggtgctccaggcctgctccgagcggcctgtccacgccgtggccagcctgggcgtgggg
ctctgcacgcggcagggccggcttgcgccgtccctgcccggtgtcgagtggatcgatgcc
gacctgccggaagtcatcgccctgcggcgcctgctcctgcctgccgtcgcggcggcatgc
ccgggccagctggtgcccggtgccctgcaggacagtgcgtggctggacgccatgccctgg
caggacggccggcacttcctcgtgctgctcgaaggcgtggcgccctatgtgcccccggcg
gacatccggcacctgctggagcggctcgcggcgcgtgcgcggcgcgaaggctgcggctgc
cgcgtggtgctcgactacctgcatccggatttcgtcccgatcgccgcctggcaggcgggc
cccgccatgctgccggtggtcagcggttttcgcgatgctgctgcactggtggaggggagc
accggcttccgtgtgctgcaggaatgccagactttcggcctgttttccgaagcgcaccgc
cggttcgaggacgaattccgcgggcgccatggccatgtgccctatgccgtggcctgcctg
gaatctgcctcttga

DBGET integrated database retrieval system