KEGG   Acidovorax avenae: Acav_2222Help
Entry
Acav_2222         CDS       T01445                                 

Definition
(GenBank) Forkhead-associated protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2484613..2485575
Genome map
AA seq 320 aa AA seqDB search
MAILRNLSSGRSIVLRPLHTFGRHPDSCRTVLQEADVSKLHAIVRWSGMRWEVADQSRNG
TLLDNARLQPAHWHGLAEGSEIRFGASAAAVWTLVDASPPRTGLWPLGGEPVLRVLDIQE
NLLPHASAAESNVFQSEGRWWWDRMDQVQPLLDGHIVQAGGQRWEFVLCEDLGATQDVPR
MPSAAALPAPLFDFDVSQDEEHVCLDIQLGGQSLSLGERIHHYTLLTLARQRLQDAGRDV
PMASQGWLAIDALARMLGVDVPYLNIQLFRARRQVQNTLGAAGDTVSVVERRRGEVRFGD
YAFRIRKGGRLEGERPGARP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttgcgcaacctttcgagcggccggagcatcgtgctccgtcccctgcatacc
ttcggccggcatccggattcgtgccgcacggtactgcaggaggccgatgtatccaagctc
catgccatcgtgcgctggtccggcatgcgctgggaggttgccgaccagagccgcaacggc
accctgctggacaatgcgcggctgcagcccgcgcactggcacggcctggcggagggctcc
gaaatccgcttcggcgcttccgccgcggccgtgtggaccctggtggatgcctcgccgccc
aggaccggcctctggccgctcgggggcgaacccgtgctgcgggtgctggacatccaggaa
aacctgctgccccatgcctccgcggccgaatccaacgtgttccagtccgaagggcgctgg
tggtgggaccgcatggaccaggtgcagcccctgctggacggccacatcgtccaggcgggc
ggccagcgctgggagttcgtgctctgcgaggacctgggtgccacgcaggacgtgccgcgc
atgccgtccgctgcggcgctgccggccccgctgttcgatttcgacgtgagccaggacgag
gagcatgtctgcctcgacatccagctgggcggccagtcgctgtccctgggcgagcgcatc
caccactacaccctgctcacgctcgcgcgccagcgactgcaggatgccgggcgggacgtt
cccatggccagccagggctggctggccatcgacgccctggcgcgcatgctgggggtcgac
gtgccgtacctgaacatccagctgttccgggcgcggcggcaggtccagaacaccctgggt
gccgcgggcgacacggtctccgtggtggagcggcgccgcggggaagtgcggttcggcgac
tatgccttccgcatccgcaagggtggccgcctcgaaggcgaacggcccggagcccggcca
tga

DBGET integrated database retrieval system