KEGG   Acidovorax avenae: Acav_2226Help
Entry
Acav_2226         CDS       T01445                                 

Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00956  
sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
aaa  Acidovorax avenae
Pathway
Purine metabolism
Monobactam biosynthesis
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Assimilatory sulfate reduction, sulfate => H2S
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Acav_2226
  Nucleotide metabolism
   00230 Purine metabolism
    Acav_2226
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acav_2226
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Acav_2226
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Acav_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2487926..2489275)
Genome map
AA seq 449 aa AA seqDB search
MAAKAATATSAGQNDHQSALRFITCGSVDDGKSTLIGRLLVDSRAVLQDHLAGVTRGGET
DLALLTDGLSAEREQGITIDVAYRYFATETRKFIIGDAPGHEQYTRNMVTAASSADAAVV
LVDATKLDWRDPQLALLPQTRRHSLLVHLLRVHSLVFAVNKLDAVDDPALAWRHIRAALE
TFARTAGIAVRATVPVSALKGWNVVDAQPGWCGYEGPSLLQILEQLPHTPADTGLALAFP
VQWVEKFSSSADTTQGRRVFWGRVAAGQVAPGTEVQVFPSGQLARVAQVLDHARQPHTVQ
AGTSAGIILDREVDVSRGDWILAAPTPAATAGADDFDTPAPVPAWPARREIRATVAWMDD
EPLVAGRVYWALHGHRWVKAKAQRVVHRLNIHTLAEEEAAQLEPNAIGHVDLLLQEALPA
APFGQARVLGSLILVDTASHRTAAAVLVN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagcagccacggccacttcggcaggccagaacgatcaccaatccgcactc
cgcttcatcacctgcggctcggtcgatgacggcaagagcacgctgatcgggcgcctgctg
gtggacagccgcgccgtgctgcaggaccacctggccggcgtgacgcgcggcggcgagacc
gatctggcgctgctcaccgacggcctctcggccgagcgcgagcagggcatcaccatcgac
gtggcctaccgctacttcgccaccgagacgcgcaagttcatcatcggcgatgcaccgggc
cacgagcagtacacccgcaacatggtcacggccgcctccagcgccgatgcggccgtggtg
ctggtcgatgccaccaagctcgactggcgcgacccgcagctggcgctgctgccgcagacg
cgccgccactccctgctggtgcacctgctgcgcgtgcattcgctggtgttcgccgtgaac
aagctcgacgcagtggacgaccccgccctcgcatggcgccacatccgggccgcgctggaa
accttcgcccggacggccggcatcgccgtgcgcgccaccgtgcccgtgtccgcgctcaag
ggatggaacgtggtcgatgcgcagcccggctggtgcggctacgaaggcccgagcctgctg
cagatcctggagcagctgccccatacgcccgccgacaccggactggccctggccttcccg
gtgcagtgggtggagaaattctcgtcctcggcagacaccacgcagggccgccgcgtgttc
tggggccgcgtcgccgcgggccaggtcgcgcccggcacggaagtgcaggtgttcccgagc
ggccagctcgcccgcgtggcacaggtgctcgaccacgcccgccaaccgcacaccgtgcag
gccggcaccagcgcgggcatcatcctcgaccgcgaagtggacgtctcgcgcggcgactgg
atactggctgcgcccacccccgcggcaacggccggcgcggacgatttcgacaccccggcg
ccggtgcccgcctggccggcgcgccgcgagatccgcgccaccgtggcctggatggacgac
gagcccctggtggccggccgcgtgtattgggcactgcacggccaccgctgggtcaaggcc
aaggcgcagcgcgtggtgcaccgcctgaacatccacacgctggccgaggaagaggcggcg
cagctggagcccaacgccatcggccacgtggacctgctgctgcaggaagccctgcccgcc
gcgccgttcggccaggcccgcgtgctgggttccctgatcctcgtggacaccgcgagccac
cgcaccgccgcagccgtgctggttaactga

DBGET integrated database retrieval system