KEGG   Acidovorax avenae: Acav_2264Help
Entry
Acav_2264         CDS       T01445                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aaa  Acidovorax avenae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Acav_2264
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Acav_2264
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Acav_2264
Lipid biosynthesis proteins [BR:aaa01004]
 Fatty acid synthase
  Component type
   Acav_2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2525879..2526544)
Genome map
AA seq 221 aa AA seqDB search
MRCDAFRRDFIVAAAGAAFLGFCAPAALAAPAASGAAPVVLVVGDSLSAEYGIARGSGWV
ALMEKKLAAEKIPATVVNASVSGDTTAGGRSRLPGLLAQHKPAVVVIELGGNDALRGLPL
QGTEANLKAMAEASRKAGAKVLIVGMQVPPNYGSDYTRRFEGVFPAVARATDSALVPFLL
KGVADRPDAAALFQADRIHPRAEAHPAMLANVWPELRKLLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgcgatgcgttccggcgtgactttatcgtggcggccgcgggggccgcgttcctg
gggttttgcgccccggcggcgctggccgcgcctgcggcttccggagctgcgcccgtcgtg
ctggtggtgggggattcgctgagcgccgaatacggcatcgcccgcggctcgggctgggtc
gcgctgatggaaaagaagctggccgcggagaagatccccgccaccgtcgtgaatgccagc
gtgagcggcgacaccacggccggaggccgctcccgcctgcccggcctgctcgcccagcac
aagcctgccgtcgtggtgatcgagctcgggggcaacgacgcgctgcgcgggctgccgctg
cagggcaccgaggcgaacctcaaggccatggcggaggcctcccgcaaggccggcgcgaag
gtgctgatcgtgggcatgcaggtgccgcccaactacggctcggactacacccggcggttc
gagggcgtgttcccggccgtggccagggccacggattccgcgctggtgcctttcctgctc
aagggcgtggccgaccggcccgatgccgcggcgctgttccaggccgaccggatccatccg
cgggccgaggcgcatccggccatgctcgcgaacgtctggcccgagttgcgcaagctcttg
cgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system