KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_2264Help
Entry
Acav_2264         CDS       T01445                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aaa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2525879..2526544)
Genome map
AA seq 221 aa AA seqDB search
MRCDAFRRDFIVAAAGAAFLGFCAPAALAAPAASGAAPVVLVVGDSLSAEYGIARGSGWV
ALMEKKLAAEKIPATVVNASVSGDTTAGGRSRLPGLLAQHKPAVVVIELGGNDALRGLPL
QGTEANLKAMAEASRKAGAKVLIVGMQVPPNYGSDYTRRFEGVFPAVARATDSALVPFLL
KGVADRPDAAALFQADRIHPRAEAHPAMLANVWPELRKLLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgcgatgcgttccggcgtgactttatcgtggcggccgcgggggccgcgttcctg
gggttttgcgccccggcggcgctggccgcgcctgcggcttccggagctgcgcccgtcgtg
ctggtggtgggggattcgctgagcgccgaatacggcatcgcccgcggctcgggctgggtc
gcgctgatggaaaagaagctggccgcggagaagatccccgccaccgtcgtgaatgccagc
gtgagcggcgacaccacggccggaggccgctcccgcctgcccggcctgctcgcccagcac
aagcctgccgtcgtggtgatcgagctcgggggcaacgacgcgctgcgcgggctgccgctg
cagggcaccgaggcgaacctcaaggccatggcggaggcctcccgcaaggccggcgcgaag
gtgctgatcgtgggcatgcaggtgccgcccaactacggctcggactacacccggcggttc
gagggcgtgttcccggccgtggccagggccacggattccgcgctggtgcctttcctgctc
aagggcgtggccgaccggcccgatgccgcggcgctgttccaggccgaccggatccatccg
cgggccgaggcgcatccggccatgctcgcgaacgtctggcccgagttgcgcaagctcttg
cgctga

DBGET integrated database retrieval system