KEGG   Acidovorax avenae: Acav_2361Help
Entry
Acav_2361         CDS       T01445                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aaa  Acidovorax avenae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acav_2361
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acav_2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2646913..2648199)
Genome map
AA seq 428 aa AA seqDB search
MPRRSVLQGGLGAAAWAATAGWSAGHAATASLPLAGMNLSGLGSNSFVENAQIGTHYRDI
SDKHIAAAGDCPLFRLPTTAQRFSTGQGLPLNATYVKEVSDVLDRLAAQGKRAILELHDY
MRLPTRVAALQGYRIQGGQLVGPDGRAVPDAAAPSVWNGTYAKGNFEYVAYFDGRDQLLK
LYEYRVIGTQGCKLYTEDGLPDLWLRLVQRFRDHPAIFGWGLMNEPYTGKETNANGSALD
MRALWQRTATRTAARIFDYDRKHFVFICGNEFATAREWVKYSNDLATIPDPYGLIVYEAH
NYLDSNGQGGGAWKNPQETVAPDTGEKMVANFLQWLQDNGKRGFLGEHGYPENNASAEVA
TRRMLQLLQRSNVPSTQWCFGPGWPDGDPLGMSRDTGADTIAVKGNIAAVQPFFKERLAT
YLPPLRSN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccgctccgtactccagggcgggctgggtgccgccgcctgggccgccacggcc
ggctggtcggcaggacacgccgccaccgcatcgctgccgctggcgggcatgaatctgtcg
ggcctcggctcgaacagtttcgtggagaacgcgcagatcggcacgcactaccgggacatc
tccgacaagcacatcgccgcggccggcgactgcccgctgttccggctgccgaccacggcg
cagcgcttcagtaccggccagggcctgccgctgaatgccacctacgtgaaggaagtgagc
gacgtactggaccggctggccgcccagggcaagcgcgcgatcctggaactgcacgactac
atgcgcctgccgacgcgggtggcggcgctgcagggctaccgcatccagggaggacagctc
gtgggcccggacggccgggccgtgcccgatgcggcagcgccgtcggtctggaacggcacc
tacgccaagggcaacttcgagtacgtcgcctacttcgacggccgcgaccagttgctcaag
ctctacgaataccgcgtgatcggcacgcagggctgcaagctctacaccgaggacggcctg
ccggacctgtggctgcgcctcgtgcagcgcttccgcgaccatccggcgattttcggctgg
ggcctgatgaacgagccctacaccggcaaggagacgaacgcgaatggcagcgcgctggac
atgcgggcgctctggcagcgcaccgcgacgcgcacggccgcgcgcatcttcgactacgac
cgcaagcacttcgtcttcatctgcggcaacgaattcgccacggcccgcgaatgggtgaaa
tactcgaacgacctcgcgaccatccccgacccgtacgggctcatcgtgtacgaggcccac
aactacctggacagcaacgggcaaggcggcggtgcctggaagaacccgcaggagaccgtg
gccccggacaccggcgagaagatggtggcgaatttcctgcaatggctgcaggacaacggc
aagcgcggtttcctgggcgagcacggctatccggaaaacaacgcgagcgccgaagtggcg
acacggcgcatgctgcagctcctgcaacggagcaacgtgcccagcacgcaatggtgcttc
ggccccggctggccggacggagacccgctggggatgagccgcgacaccggcgcggacacc
atcgccgtcaagggcaacatcgcggcggtgcagcccttcttcaaggaacgcctggcaacc
tacttgccgccgctgcgctcgaactga

DBGET integrated database retrieval system