KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_2425Help
Entry
Acav_2425         CDS       T01445                                 

Definition
three-deoxy-D-manno-octulosonic-acid transferase domain-containing protein
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:aaa00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2729093..2730361
Genome map
AA seq 422 aa AA seqDB search
MWGARPLLLRKLRRRAVAEPGYGHAVEERFGQYGQAAAPGRDSPDGPLVWIHAVSLGETR
AAAILLNELRSQLPGMRLLLTHGTATGRAEGARLLRPGDVQVWQPWDTPGAVGRFLEHFR
PAIGVLMETEIWPNLVAGCRQRGIPLVLANARLNEKSLAGARRWAWLARPAYAGLSAAWA
QTEADAERLRAAGARVEGVFGNLKFDVVPDAAQLAQGRAWRDASPHPVVLLASSREGEEA
LWLEALHALQSTTGSMAHAGVQWLLVPRHPQRVAEVRQRIEVAGLTVSSRSGWAGAPGAA
DVWLGDSLGEMALYYGMAHAALLGGSFAPLGGQNLIEAAACGCPVVTGPHTFNFAEAARL
ACEAGAALRVADMAEGVAAARALVHDAAALAATRDRALAFTQAHRGAARATATAVVRQLQ
GR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcgcccggcccctgttgctgcgcaagctgcgccgccgcgcggtggccgagccg
ggctacggccatgcggtggaggagcgtttcgggcagtatggacaggctgcggcacctggg
agggactcccctgacggaccgctggtctggatccatgccgtctcgctgggcgaaacccgc
gccgctgccatcctgctgaacgaactgcgcagccagttgcccggcatgcgcctgctgctg
acccacggcaccgccacgggccgcgccgaaggggccaggctgctgcggcccggtgacgtg
caggtctggcagccatgggatacccctggagccgtgggccgcttcctcgagcatttccgg
cccgcgatcggcgtgctgatggaaaccgagatctggcccaatctggtggcgggctgccgg
cagcgcggcattccactggtgctggccaatgcgcggctcaacgagaagtcgctggcgggc
gcgcggcgctgggcctggctggcgcggcccgcctacgcaggactgtcggcggcctgggcg
cagaccgaggccgatgccgaacgcctgcgcgcggccggtgcccgggtggaaggcgtcttc
ggcaacctgaaattcgacgtggtgcccgatgcggcgcagctggcgcagggcagggcatgg
cgcgacgccagcccgcacccggtggttctgctggccagcagccgcgagggcgaggaagcg
ctgtggctggaggctttgcatgccttgcagtccaccacgggaagcatggcccatgccggc
gtgcagtggctgctcgtgccgcgccacccgcagcgcgtggccgaggtgcgccagcgcatc
gaggtggccggcctcacggtctccagccgcagcggctgggccggtgcgcccggcgcggcc
gacgtgtggctgggcgattcgctgggcgagatggcgctctactacggcatggcgcacgcg
gctctgctgggtggcagcttcgcgccgctgggcgggcagaacctgatcgaggccgcggcc
tgcggctgccccgtggtgaccggtccgcacaccttcaacttcgccgaggcggcgcggctc
gcctgcgaggcgggcgccgcgctgcgcgtggcggacatggccgaaggcgtcgcggccgcc
agggccctggtgcacgacgcggccgcgctcgccgccacccgggaccgcgccctggcgttc
acccaggcgcaccggggcgccgcgcgggccacggcaacggccgtagtgcggcaactgcag
gggcgctga

DBGET integrated database retrieval system