KEGG   Acidovorax avenae: Acav_2425Help
Entry
Acav_2425         CDS       T01445                                 

Definition
three-deoxy-D-manno-octulosonic-acid transferase domain-containing protein
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
aaa  Acidovorax avenae
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Acav_2425
Enzymes [BR:aaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     Acav_2425
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     Acav_2425
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     Acav_2425
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     Acav_2425
Glycosyltransferases [BR:aaa01003]
 Polysaccharide
  Bacterial polysaccharide
   Acav_2425
Lipopolysaccharide biosynthesis proteins [BR:aaa01005]
 Core region
  Acav_2425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2729093..2730361
Genome map
AA seq 422 aa AA seqDB search
MWGARPLLLRKLRRRAVAEPGYGHAVEERFGQYGQAAAPGRDSPDGPLVWIHAVSLGETR
AAAILLNELRSQLPGMRLLLTHGTATGRAEGARLLRPGDVQVWQPWDTPGAVGRFLEHFR
PAIGVLMETEIWPNLVAGCRQRGIPLVLANARLNEKSLAGARRWAWLARPAYAGLSAAWA
QTEADAERLRAAGARVEGVFGNLKFDVVPDAAQLAQGRAWRDASPHPVVLLASSREGEEA
LWLEALHALQSTTGSMAHAGVQWLLVPRHPQRVAEVRQRIEVAGLTVSSRSGWAGAPGAA
DVWLGDSLGEMALYYGMAHAALLGGSFAPLGGQNLIEAAACGCPVVTGPHTFNFAEAARL
ACEAGAALRVADMAEGVAAARALVHDAAALAATRDRALAFTQAHRGAARATATAVVRQLQ
GR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcgcccggcccctgttgctgcgcaagctgcgccgccgcgcggtggccgagccg
ggctacggccatgcggtggaggagcgtttcgggcagtatggacaggctgcggcacctggg
agggactcccctgacggaccgctggtctggatccatgccgtctcgctgggcgaaacccgc
gccgctgccatcctgctgaacgaactgcgcagccagttgcccggcatgcgcctgctgctg
acccacggcaccgccacgggccgcgccgaaggggccaggctgctgcggcccggtgacgtg
caggtctggcagccatgggatacccctggagccgtgggccgcttcctcgagcatttccgg
cccgcgatcggcgtgctgatggaaaccgagatctggcccaatctggtggcgggctgccgg
cagcgcggcattccactggtgctggccaatgcgcggctcaacgagaagtcgctggcgggc
gcgcggcgctgggcctggctggcgcggcccgcctacgcaggactgtcggcggcctgggcg
cagaccgaggccgatgccgaacgcctgcgcgcggccggtgcccgggtggaaggcgtcttc
ggcaacctgaaattcgacgtggtgcccgatgcggcgcagctggcgcagggcagggcatgg
cgcgacgccagcccgcacccggtggttctgctggccagcagccgcgagggcgaggaagcg
ctgtggctggaggctttgcatgccttgcagtccaccacgggaagcatggcccatgccggc
gtgcagtggctgctcgtgccgcgccacccgcagcgcgtggccgaggtgcgccagcgcatc
gaggtggccggcctcacggtctccagccgcagcggctgggccggtgcgcccggcgcggcc
gacgtgtggctgggcgattcgctgggcgagatggcgctctactacggcatggcgcacgcg
gctctgctgggtggcagcttcgcgccgctgggcgggcagaacctgatcgaggccgcggcc
tgcggctgccccgtggtgaccggtccgcacaccttcaacttcgccgaggcggcgcggctc
gcctgcgaggcgggcgccgcgctgcgcgtggcggacatggccgaaggcgtcgcggccgcc
agggccctggtgcacgacgcggccgcgctcgccgccacccgggaccgcgccctggcgttc
acccaggcgcaccggggcgccgcgcgggccacggcaacggccgtagtgcggcaactgcag
gggcgctga

DBGET integrated database retrieval system