KEGG   Acidovorax avenae: Acav_2753Help
Entry
Acav_2753         CDS       T01445                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aaa  Acidovorax avenae
Pathway
aaa00010  Glycolysis / Gluconeogenesis
aaa00020  Citrate cycle (TCA cycle)
aaa00620  Pyruvate metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
Module
aaa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_2753
   00020 Citrate cycle (TCA cycle)
    Acav_2753
   00620 Pyruvate metabolism
    Acav_2753
Enzymes [BR:aaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Acav_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H RnfC_N NQRA
Motif
Other DBs
NCBI-ProteinID: ADX46662
JGI: Acav_2753
UniProt: F0Q378
Position
complement(3114352..3116049)
Genome map
AA seq 565 aa AA seqDB search
MALIDIKVPDIGDFDAVGVIELLVKPGDTVKAEQSLITVESDKASMEIPSSHAGVVKEVK
VKVGDQVSEGSVIVVVEAEGEGAQPAAAPAAKADAPAPAPATASAPAPAAPAPAPAAAGP
IDVKVPDIGDFKDVAVIELLVKPGDTVKEEQSLFTVESDKASMEIPSPAAGVVKELKIKI
GDKVNVGDLVAVLEGAVGAPSAAPAAAPVDRPAPQSEPDARAPRQLPAEEAAPQAGATAA
SAPAPAPHAPGAAPIGLPHASPSVRKFARELGVPLEEIKGSGPKGRITQEDVQAFTRQVM
AGGVQTKAQAAKAPAGGGSGVGMDLLPWPKVDFSKFGGVERKDLSRIKKISGANLHRNWV
MIPHVTNNDEADITELEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNTSLDG
DTLVYKQYFHIGFAADTPNGLVVPVLKDADKKGILQISQEMGELAKKARDGKLGAADMQG
GCFSISSLGGIGGTHFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLVLPLSLSYDHRV
IDGASAARFNAYLGQVLADYRRILL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcactgattgacatcaaggtcccggatatcggggatttcgacgccgtcggcgtgatc
gaactgctggtgaagcccggcgacacggtgaaggccgagcagtcgctcatcaccgtggag
tccgacaaggcttccatggagatcccttccagccacgccggcgtggtgaaggaggtcaag
gtcaaggtcggcgaccaggtgagcgaaggctccgtgatcgtggtggtcgaggccgaaggc
gagggcgcgcagcccgccgccgcacccgctgcgaaagcggacgcacctgctcccgccccg
gccactgcatccgctccggcaccggctgcgcccgcacccgccccggcggctgcgggtccg
atcgatgtgaaggtgccggacatcggcgacttcaaggacgtggcggtgatcgaactgctg
gtgaagcccggcgatacggtcaaggaagagcagtcgcttttcaccgtggaatccgacaag
gcttcgatggagatcccgtcgcccgccgccggcgtggtgaaggaactgaagatcaagatc
ggcgacaaggtgaacgtgggtgacctcgtggccgtgctggaaggcgccgtcggagccccg
tcggctgcacccgccgcagcaccggtggatcgtccggcaccccagtccgaacccgacgcg
cgcgctccccgccaactgccggccgaggaggccgctccgcaggccggcgccacggctgcc
tctgctccggcgcctgctccgcatgccccgggcgccgcgcccatcggcctgccgcatgca
tctccctcggtgcgcaagttcgcccgcgaactgggcgtgccgctggaagagatcaagggt
tccggccccaagggccgcatcacgcaggaggacgtccaggccttcaccaggcaggtgatg
gcgggcggcgtgcagaccaaggcccaggcggccaaggcgcctgccggcggcggctccggc
gttggcatggacctgctgccctggccgaaggtggacttctccaagttcggcggcgtggag
cgcaaggacctctcgcgcatcaagaagatcagcggcgccaacctgcaccgcaactgggtg
atgatcccccacgtcaccaacaacgacgaggccgacatcaccgagctggaagccttccgc
gtctccaccaacaaggagaacgagaagtccggcgtgaaggtgacgatgctcgccttcgtg
atcaaggccgtggtggccgcgctcaagaagttccccgagttcaacaccagcctggacggc
gacacgctcgtctacaagcagtacttccacatcggcttcgcggcggacacgcccaacggc
ctggtggtgcccgtgctcaaggatgccgacaagaagggcatcctgcagatcagccaggaa
atgggtgagctcgccaagaaggcccgcgacggcaagctcggcgcggccgacatgcagggc
ggttgcttctcgatctcgtcgctcgggggcatcggtggcacgcacttcacgcccatcatc
aacgcacccgaagtggccatcctgggcctctcgaagggccagatgaagccggtgtgggat
ggcaagcagttcgtgccgcgcctggtgctgccgctgtcgctctcctacgaccaccgcgtg
atcgatggcgcatctgccgcgcgcttcaacgcctacctgggccaggtgttggcggactac
cgccgcatcctgctgtga

DBGET integrated database retrieval system