KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3053Help
Entry
Acav_3053         CDS       T01445                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aaa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3456339..3457799
Genome map
AA seq 486 aa AA seqDB search
MAHLGSVGRAVALAASLLACSGAAWSYSISNGQVVDDAGQAVQLRGVNWFGFETGEHVVH
GLWARNWKDMIGQMQQQGFNAVRLPFCPQSLRGTGPGSIDYSRNPDLQGLNSQQILDKVV
QEISDRGMFVLLDHHTPDCQAISELWYTPAYSEQQWIADLVFAANRYKGVPGVIGIDLKN
EPHGAATWGTGNAATDWNRAAERAAAAVAQAAPRWIVAVEGIGENPSCSTGSGHFWGGNL
EPLACTPLDIPADRLLLAPHTYGPDVAMQSYFNAADFPANMSAIWEQHFGRFVQAGHAVL
PGEFGGKYGRGDPRDVQWQNALVDYLIGKGIRSGFYWSWNPNSGDTGGILDDDWNTVRTD
KVQLLNRLWGTGGANPNPNPNPNPNPNPNPNPNPNPNPNPNPGASFGVKQITDNDWGAGY
CQRVQVTNSGGAAGDWTVSIGVQGTVNNLWNAVWAQSGSTLQASGVSWNRTLAPGGTAEF
GFCAAR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcttggatccgtggggagggccgtcgcactggccgccagcctgctcgcatgc
agcggcgcggcatggagctattccatcagcaacggccaggtggtggacgacgccggccag
gccgtgcagctgcgtggcgtgaactggttcggcttcgagaccggagagcacgtggtccac
ggcctctgggcgcgcaactggaaggacatgatcggccagatgcagcagcagggcttcaat
gccgtgcgcctgcccttctgtccgcaaagcctgcgtggcaccggccccggcagcatcgac
tacagccgcaaccccgacctgcagggactgaactcgcagcagatcctcgacaaggtcgtg
caggaaatcagcgaccgtggcatgttcgtgctgctggaccaccacacgccggactgccag
gccatcagcgagctctggtacacgccggcctacagcgaacagcagtggatcgccgacctg
gtcttcgccgccaaccgctacaaaggcgtgcctggggtgatcggcatcgacctgaagaac
gagccccatggcgccgccacctggggcaccggcaatgccgccaccgactggaaccgcgcc
gcagagcgcgccgccgccgcggtcgcgcaggccgcgccgcgctggatcgtcgcggtggaa
ggcatcggcgagaacccctcctgctccaccggcagcggccacttctggggaggcaacctg
gagccactggcctgcacgccgctggacatcccggccgaccgcctgctgctggcgccgcac
acatacgggccggacgtggccatgcagtcgtatttcaatgcagcggatttccccgccaac
atgtccgccatctgggagcagcacttcggccgcttcgtgcaggccggccacgccgtgctg
ccgggcgaattcggcggcaagtacggccgcggcgacccgcgcgacgtgcagtggcagaac
gccctggtggactacctgatcggcaagggcatccgcagcggcttctactggtcctggaac
cccaacagcggcgacaccggcggcatcctggacgacgactggaacacggtgcgcacggac
aaggtgcaactcctgaaccggctctggggcacgggcggggccaaccccaaccccaacccc
aaccccaacccgaacccgaacccgaacccgaatccgaatccgaatccgaatccgaatccg
aatccgggggcgagcttcggcgtcaagcagatcaccgacaacgactggggcgcgggctac
tgccagcgcgtgcaggtgaccaacagcggcggcgccgcaggcgactggacggtctccatc
ggcgtgcagggcacggtcaacaatctctggaatgcggtctgggcgcagtcgggcagcacg
ctgcaggcctccggtgtgtcgtggaaccgcacgctcgcgcccgggggcacggcggaattc
ggcttctgcgcggcgcgctga

DBGET integrated database retrieval system