KEGG   Acidovorax avenae: Acav_3135Help
Entry
Acav_3135         CDS       T01445                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aaa  Acidovorax avenae
Pathway
aaa00500  Starch and sucrose metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
Module
aaa_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acav_3135
Enzymes [BR:aaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Acav_3135
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acav_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADX47037
JGI: Acav_3135
UniProt: F0Q7G4
Position
3564523..3566565
Genome map
AA seq 680 aa AA seqDB search
MRQWLAADTVVRKPAFLLRSFFPDLLQDPTVPSNDSSLLTAHDAYLLREGTHARLYQSLG
CHLRRTAGVPAQEARGADFAVWAPNAASVSVIGDWNGWNPEADPLAPRGDDSGVWEGFAP
HAAHGQAYKFRIVSRNGGRVLEKADPLAICSELPPRTASRIWDLDYTWNDGEWMASRGPR
NALGAPMSIYEVHAGSWRRKDGQFMGYRELAHALGEYVQSMGFTHVELMPITEHPFYGSW
GYQTTGYFAPTSRYGTPQDFMYFVDHLHQRGIGVLLDWVPSHFPMDGHGLAEFDGTHLYE
HADPRQGFHPEWNSAIFNYGRNEVRSFLVSSGLFWLDKYHLDGLRVDAVASMLYLDYARK
QGEWVPNRHGGRENLEAIEFMRLLNRSLYRDHPDTVSIAEESTAWPMVSRPVEMNGLGFG
MKWNMGWMHDTLSYFKEDPVHRRYHHHKLTFSLVYAFNENFVLPLSHDEVVYGKGSLVNK
MPGDEWHQFANLRALFGLMWAHPGKKLLFMGGEFGQRREWTHEGELEWWVCDGPLHGGLQ
RMVRELNRVLRSEPALHDIDFSPEGFQWVEADDAGRSVIAFLRKPGAEAQRQGATPVLVV
CNMTPVPRENYLVGVPSAGYWRELFNSDAREFGGAGWGNLGGVEAAPVRSHHWAQSLCLT
LPPLSTLILRQEPARHAFPA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaatggcttgcagccgacacggtcgtgcggaagccggctttcttgttgcgttcc
ttcttccccgaccttctccaggatcccaccgtgccgtccaacgactcctccctgctgacc
gcccacgacgcctacctgctgcgcgagggcacgcatgcccgcctctaccagtcgctgggc
tgccacctgcgccgcacggccggcgtgcctgcgcaggaggcgcgcggcgcggacttcgcg
gtctgggccccgaatgcggcgtcggtctcggtgatcggggactggaacggctggaacccg
gaggccgacccgctggcgccgcgcggcgacgacagcggcgtgtgggagggcttcgcgccc
cacgcggcccacgggcaggcctacaagttccgcatcgtgtcgcgcaacggcggccgggtg
ctggaaaaggcggatccgctggccatctgctccgagctgccgccgcgcaccgcatcgcgc
atctgggacctcgactacacctggaacgacggcgagtggatggcctcgcgcggcccgcgc
aatgcgctgggtgccccgatgtcgatctacgaggtgcatgcgggctcctggcgccgcaag
gatggccagttcatgggctaccgcgaactggcccatgcgctgggcgagtacgttcagtcg
atgggcttcacccacgtggagctgatgcccatcaccgagcatccgttctatggctcctgg
ggctaccagaccaccgggtatttcgcgcccacgtcgcgctacggcacgccgcaggatttc
atgtacttcgtggaccacctgcaccagcgcggcatcggcgtgctgctggactgggtgccc
tcgcacttcccgatggacgggcatggtctggcggagttcgacggcacgcacctgtacgag
cacgccgacccacggcagggtttccatccggagtggaattcggccatcttcaactacggc
cgcaacgaggtgcgcagcttcctcgtctcctcgggcctgttctggctcgacaagtaccac
ctggacggcctgcgcgtggacgcggtggcgtccatgctgtacctggactacgcgcgcaag
cagggcgaatgggtgcccaaccgccacggcgggcgcgagaacctggaggcgatcgagttc
atgcggctgctcaaccgctcgctctaccgcgaccacccggacacagtgagcatcgccgag
gaatccaccgcctggcccatggtctcgcgccccgtggaaatgaacggactgggcttcggc
atgaagtggaacatgggctggatgcacgacacgctgtcgtacttcaaggaagacccggtc
caccgccgctaccaccaccacaagctgacgttctcgctggtctacgccttcaacgagaac
ttcgtgctgccgctctcgcacgacgaggtggtctatggcaagggatcgctcgtcaacaag
atgccgggcgacgaatggcatcagttcgccaacctgcgcgcgctgttcggcctgatgtgg
gcccaccccggcaagaagctgctcttcatgggcggcgaattcggccagcgccgcgaatgg
acgcacgagggcgaactcgagtggtgggtctgcgacggcccgctgcacggcggcctgcag
cgcatggtgcgcgagctcaaccgcgtgctgcgcagcgagccggccctgcacgacatcgat
ttctcccccgagggcttccagtgggtggaggccgacgacgccggccgcagcgtgatcgcc
ttcctgcgcaagcccggcgccgaggcccagcgccagggtgccacgccggtgctggtggtc
tgcaacatgacgccggtgccgcgcgagaactacctcgtgggggtgccttccgccggctac
tggcgggaactgttcaacagcgatgcccgcgaattcggcggcgccggctggggcaacctg
ggcggcgtggaagccgcgcccgtgcgctcgcaccactgggcgcagtcgctatgcctcacg
ctgccgccgctgtccaccctcatcctccgacaggagcctgcacgccatgccttccccgcc
tga

DBGET integrated database retrieval system