KEGG   Acidovorax avenae: Acav_3135Help
Entry
Acav_3135         CDS       T01445                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aaa  Acidovorax avenae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acav_3135
Enzymes [BR:aaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Acav_3135
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acav_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3564523..3566565
Genome map
AA seq 680 aa AA seqDB search
MRQWLAADTVVRKPAFLLRSFFPDLLQDPTVPSNDSSLLTAHDAYLLREGTHARLYQSLG
CHLRRTAGVPAQEARGADFAVWAPNAASVSVIGDWNGWNPEADPLAPRGDDSGVWEGFAP
HAAHGQAYKFRIVSRNGGRVLEKADPLAICSELPPRTASRIWDLDYTWNDGEWMASRGPR
NALGAPMSIYEVHAGSWRRKDGQFMGYRELAHALGEYVQSMGFTHVELMPITEHPFYGSW
GYQTTGYFAPTSRYGTPQDFMYFVDHLHQRGIGVLLDWVPSHFPMDGHGLAEFDGTHLYE
HADPRQGFHPEWNSAIFNYGRNEVRSFLVSSGLFWLDKYHLDGLRVDAVASMLYLDYARK
QGEWVPNRHGGRENLEAIEFMRLLNRSLYRDHPDTVSIAEESTAWPMVSRPVEMNGLGFG
MKWNMGWMHDTLSYFKEDPVHRRYHHHKLTFSLVYAFNENFVLPLSHDEVVYGKGSLVNK
MPGDEWHQFANLRALFGLMWAHPGKKLLFMGGEFGQRREWTHEGELEWWVCDGPLHGGLQ
RMVRELNRVLRSEPALHDIDFSPEGFQWVEADDAGRSVIAFLRKPGAEAQRQGATPVLVV
CNMTPVPRENYLVGVPSAGYWRELFNSDAREFGGAGWGNLGGVEAAPVRSHHWAQSLCLT
LPPLSTLILRQEPARHAFPA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaatggcttgcagccgacacggtcgtgcggaagccggctttcttgttgcgttcc
ttcttccccgaccttctccaggatcccaccgtgccgtccaacgactcctccctgctgacc
gcccacgacgcctacctgctgcgcgagggcacgcatgcccgcctctaccagtcgctgggc
tgccacctgcgccgcacggccggcgtgcctgcgcaggaggcgcgcggcgcggacttcgcg
gtctgggccccgaatgcggcgtcggtctcggtgatcggggactggaacggctggaacccg
gaggccgacccgctggcgccgcgcggcgacgacagcggcgtgtgggagggcttcgcgccc
cacgcggcccacgggcaggcctacaagttccgcatcgtgtcgcgcaacggcggccgggtg
ctggaaaaggcggatccgctggccatctgctccgagctgccgccgcgcaccgcatcgcgc
atctgggacctcgactacacctggaacgacggcgagtggatggcctcgcgcggcccgcgc
aatgcgctgggtgccccgatgtcgatctacgaggtgcatgcgggctcctggcgccgcaag
gatggccagttcatgggctaccgcgaactggcccatgcgctgggcgagtacgttcagtcg
atgggcttcacccacgtggagctgatgcccatcaccgagcatccgttctatggctcctgg
ggctaccagaccaccgggtatttcgcgcccacgtcgcgctacggcacgccgcaggatttc
atgtacttcgtggaccacctgcaccagcgcggcatcggcgtgctgctggactgggtgccc
tcgcacttcccgatggacgggcatggtctggcggagttcgacggcacgcacctgtacgag
cacgccgacccacggcagggtttccatccggagtggaattcggccatcttcaactacggc
cgcaacgaggtgcgcagcttcctcgtctcctcgggcctgttctggctcgacaagtaccac
ctggacggcctgcgcgtggacgcggtggcgtccatgctgtacctggactacgcgcgcaag
cagggcgaatgggtgcccaaccgccacggcgggcgcgagaacctggaggcgatcgagttc
atgcggctgctcaaccgctcgctctaccgcgaccacccggacacagtgagcatcgccgag
gaatccaccgcctggcccatggtctcgcgccccgtggaaatgaacggactgggcttcggc
atgaagtggaacatgggctggatgcacgacacgctgtcgtacttcaaggaagacccggtc
caccgccgctaccaccaccacaagctgacgttctcgctggtctacgccttcaacgagaac
ttcgtgctgccgctctcgcacgacgaggtggtctatggcaagggatcgctcgtcaacaag
atgccgggcgacgaatggcatcagttcgccaacctgcgcgcgctgttcggcctgatgtgg
gcccaccccggcaagaagctgctcttcatgggcggcgaattcggccagcgccgcgaatgg
acgcacgagggcgaactcgagtggtgggtctgcgacggcccgctgcacggcggcctgcag
cgcatggtgcgcgagctcaaccgcgtgctgcgcagcgagccggccctgcacgacatcgat
ttctcccccgagggcttccagtgggtggaggccgacgacgccggccgcagcgtgatcgcc
ttcctgcgcaagcccggcgccgaggcccagcgccagggtgccacgccggtgctggtggtc
tgcaacatgacgccggtgccgcgcgagaactacctcgtgggggtgccttccgccggctac
tggcgggaactgttcaacagcgatgcccgcgaattcggcggcgccggctggggcaacctg
ggcggcgtggaagccgcgcccgtgcgctcgcaccactgggcgcagtcgctatgcctcacg
ctgccgccgctgtccaccctcatcctccgacaggagcctgcacgccatgccttccccgcc
tga

DBGET integrated database retrieval system