KEGG   Acidovorax avenae: Acav_3142Help
Entry
Acav_3142         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX47044
JGI: Acav_3142
UniProt: F0Q7H1
Position
3575998..3576726
Genome map
AA seq 242 aa AA seqDB search
MRPRLPAGRTGQPGVLGGGVCRGTRFALRATLGQPRQVSSRSGRVLRHARHPTPCAPQAH
PEGVIRAFALLGPKAFAALGKKPNAPLQGKRCAVRSTRAPQAERSNGPCAAPRPRGCAEE
RRARGGQACRRTRLLRDLARRGCPSAARSAKRVPRRRPATEHHRLPPSPNRAKGDADTRA
RLFFAYFLLAKQKKVGAPPGAHPGPGKKPPPKKEKRRPQGRPKETRSFFLYPANPLRASA
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccccgtttgcccgcagggcgaacggggcaacctggggtgctcgggggtggggtg
tgccgtggaactcgcttcgcgctgcgcgctacgctcggacaaccacggcaagtcagttca
cgaagcggacgtgtcctgcggcacgcccgccaccccaccccctgcgcgccccaagcgcat
ccagaaggggtgatccgggccttcgcgttgctcggccccaaagccttcgctgcgctcggc
aaaaaacccaacgctccgctccaaggaaaacggtgcgcggtgcgtagcactcgcgcaccc
caggccgagcgaagcaatggcccgtgtgctgccccccgccctcgtggctgcgccgaggag
cgcagggcgcggggcgggcaggcgtgccgcaggacacgcctgcttcgtgatctggctcgc
cgtggttgtccgagcgcagcgcgcagcgcgaagcgagttccacggcgccgccccgcgacc
gagcaccacaggctgcccccttcgcccaacagggcgaagggggacgcagacaccagggct
cgccttttctttgcctactttcttttggcgaagcaaaagaaagtaggtgcgccgccgggc
gcacatcccggccccgggaaaaaaccacccccaaaaaaagaaaaaaggcgaccccaaggc
cgccccaaagaaacacgcagcttcttcttgtacccagccaacccgctcagagcttctgcg
cctgcatga

DBGET integrated database retrieval system