KEGG   Acidovorax avenae: Acav_3145Help
Entry
Acav_3145         CDS       T01445                                 

Definition
(GenBank) Geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
aaa  Acidovorax avenae
Pathway
aaa00900  Terpenoid backbone biosynthesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acav_3145
Enzymes [BR:aaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Acav_3145
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Acav_3145
Prenyltransferases [BR:aaa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Acav_3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ADX47047
JGI: Acav_3145
UniProt: F0Q7H4
Position
complement(3579953..3580873)
Genome map
AA seq 306 aa AA seqDB search
MGTAALSPHAGDAGFDLSAWSAQALQRVEEALEAWVPADAPGGLGDAMRYAVLGAGKRLR
PLLVLAAAEAVSGHAGAALRAACSVELIHAYSLVHDDMPCMDNDVLRRGKPTVHVQFGQA
QALLAGDALQALAFELLTPEDDVPEAMQARLCRLLARAAGADGMAGGQAIDLASVGIALS
EDELRRMHRLKTGALLQSSVLMGAACGAAAPAAWDALSRYGAALGLAFQVVDDVLDVVAD
SATLGKTAGKDAASDKPTYVSLLGLDQARAYAAALRDEAHAALQGSGLAGTRVLAALADM
VIDRSR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgctgcgctttccccgcacgccggcgacgccggcttcgacctttccgcatgg
agcgcgcaggcgctgcagcgcgtcgaggaagccctggaggcctgggtgcccgccgatgcc
ccgggcggcctgggcgatgccatgcgctacgcggtgctgggcgccggcaagcgcctgcgc
ccgctgctggtgctcgccgcggccgaggccgtgtcgggccacgctggcgcggcgctgcgc
gcggcctgctcggtggagctgatccacgcctattcgctggtgcacgacgacatgccctgc
atggacaacgacgtgctgcgccgcggcaagcccacggtgcacgtgcagttcggccaggcc
caggcgctgcttgcgggcgatgcgctgcaggccctggcgttcgagctgctcacgcccgag
gacgacgtgcccgaggccatgcaggcccggctgtgccgcctgctggcacgggccgcgggc
gccgacggcatggccggcgggcaggcgatcgacctggccagcgtgggcatcgcgctgtcg
gaggacgaactgcgccgcatgcaccgcctcaagaccggggcgctgctgcagtccagcgtg
ctgatgggcgcggcctgcggagcggcggcccccgcggcgtgggacgccctgtcgcgctac
ggcgcggccctggggctcgccttccaggtggtggacgacgtgctggacgtggtggccgat
tccgccacgctgggcaagacggccggcaaggacgcggccagcgacaagcctacctatgtc
tcgctgctcgggctggaccaggcacgcgcctatgcggccgccctgcgcgacgaggcgcat
gccgccctgcagggcagcggcctggcgggcacgcgcgtgctggcggcgctggccgacatg
gtgatcgaccgatcccgctga

DBGET integrated database retrieval system