KEGG   Acidovorax avenae: Acav_3149Help
Entry
Acav_3149         CDS       T01445                                 

Definition
(GenBank) 3-mercaptopyruvate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
aaa  Acidovorax avenae
Pathway
aaa00270  Cysteine and methionine metabolism
aaa00920  Sulfur metabolism
aaa01100  Metabolic pathways
aaa01120  Microbial metabolism in diverse environments
aaa04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Acav_3149
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Acav_3149
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Acav_3149
Enzymes [BR:aaa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     Acav_3149
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     Acav_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ADX47051
JGI: Acav_3149
UniProt: F0Q7H8
Position
3583782..3584681
Genome map
AA seq 299 aa AA seqDB search
MAYTTLISADELKALRASGAPLMVFDCSFDLAHPSRGQQQYLESHIPGAVYAHLDESLSA
RHGVPGAGGTIVAKEGEMPSSGGRHPLPHPERFAAWLSSVGFSNAMQAVVYDRNGTNFCG
RLWWMLQWAGHEAVAVLDGGLQAWEQAGGELAHGEEPAHFQANFALGEPLQRLATAAEVQ
AALGRPGQTVVDARAPARYRGEVEPLDPVAGHIPGALNRPFSDNLGPDGRFKPAAQLRAE
FESLLAGRDPSTVVHQCGSGVSATPNVLAMQVAGLGRTALFAGSWSEWCSDPSRPVERG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcctataccaccctcatttccgccgacgaactcaaggcgctgcgcgcgagcggcgcg
ccgctgatggtcttcgactgcagcttcgacctggcgcacccttcgcgcgggcagcagcaa
tacctcgagtcgcacatcccaggagcggtgtacgcgcacctcgacgaatcgctcagcgcc
cggcacggcgtgcccggcgcgggcggcaccatcgtggcgaaggaaggcgaaatgccgtcg
tcgggcggccggcacccgctgccccatcccgagcgcttcgccgcctggctctcctcggtg
ggcttttccaatgcgatgcaggcggtggtgtacgaccgcaacggcaccaacttctgcggg
cgcctgtggtggatgctgcagtgggcaggccacgaagccgtggcggtgctcgacggcgga
ctgcaggcctgggagcaggccggcggcgaactcgcacacggcgaggagcccgcgcacttc
caggcgaacttcgccctgggcgagcccctgcagcggctggccacggccgccgaggtccag
gccgcgctgggccggccaggccagacggtggtggatgcacgcgcgcccgcgcgctaccgc
ggcgaggtggagccgctcgatccggtcgccggccacattcccggcgcgctgaaccgcccg
ttctccgacaacctcgggcccgacggccgcttcaagccggccgcgcagctgcgggccgaa
ttcgaatcgctgctagcgggccgtgatccctccaccgtggtgcaccagtgcggcagcggc
gtgagcgccacgcccaacgtgctggccatgcaggtcgccgggctgggcaggaccgcgctg
ttcgcgggcagctggagcgagtggtgcagcgatccgtcccgccccgtcgagcgcggctga

DBGET integrated database retrieval system