KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3164Help
Entry
Acav_3164         CDS       T01445                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aaa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3602989..3603828
Genome map
AA seq 279 aa AA seqDB search
MHRAPPPAAPRRAIVTRPERDATQWVVHLHARGIDAVALPLIAIRGCAHPEARAALQAAR
EAWPRWRAVMFVSSNAAHYFLDPPGTGAALFAGDPAALPRIWAPGPGTAQALRQAGVPAE
AIDRPAAEATQFDSESLWAQVAPQVRQGDRILIVRGAQADGDGTDTVAGTGREWLAQQIA
AAGGQAEFVAAYERGAPDFSAEQLALARAAATDGSLWLFSSSEAVAHLGAALPGQDWSGA
RALATHPRIAQAAQDAGFGAVRQCRPALNDVVASIESHP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgcgcccccccgcctgcggccccgcgccgcgccatcgtcacccgcccggagcgc
gacgccacgcagtgggtcgtgcacctgcatgcgcgcggcatcgacgccgtggccctgccc
ctcatcgccatccggggatgcgcccatcccgaagcccgcgcggcactgcaggcagcccgc
gaagcctggccccgctggcgcgcggtgatgttcgtgagcagcaacgcggcccactatttc
cttgatccgccaggaacgggcgccgcactcttcgccggcgatccggccgcgctgccgcgg
atctgggcgcccggccccggcaccgcccaggcgctgcggcaggccggcgtgcccgcggaa
gccatcgaccggcccgcggccgaggccacgcagttcgactccgaatccctctgggcacag
gtggcgccgcaggtgcggcagggcgaccgcatcctcatcgtgcgcggcgcgcaggccgac
ggcgacggcacggacaccgtcgcaggcacggggcgcgaatggctcgcgcaacagatcgcc
gcggccggcgggcaggccgaattcgtcgcagcctatgaacgcggcgcccccgacttcagc
gcagagcaactggccctcgcccgcgccgcggccacggacggctcgctctggcttttcagc
agctccgaggcggtggcccacctgggcgcagcactgcccgggcaggactggtccggcgcg
cgcgcgctcgccacccacccccgcatcgcgcaggccgcgcaggacgccggcttcggggcc
gtgcgccagtgccgcccggccctgaacgacgtggtcgcatcgatagaatcccacccatga

DBGET integrated database retrieval system