KEGG   Acidovorax avenae: Acav_3164Help
Entry
Acav_3164         CDS       T01445                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aaa  Acidovorax avenae
Pathway
aaa00860  Porphyrin and chlorophyll metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acav_3164
Enzymes [BR:aaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Acav_3164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADX47066
JGI: Acav_3164
UniProt: F0Q7J3
Position
3602989..3603828
Genome map
AA seq 279 aa AA seqDB search
MHRAPPPAAPRRAIVTRPERDATQWVVHLHARGIDAVALPLIAIRGCAHPEARAALQAAR
EAWPRWRAVMFVSSNAAHYFLDPPGTGAALFAGDPAALPRIWAPGPGTAQALRQAGVPAE
AIDRPAAEATQFDSESLWAQVAPQVRQGDRILIVRGAQADGDGTDTVAGTGREWLAQQIA
AAGGQAEFVAAYERGAPDFSAEQLALARAAATDGSLWLFSSSEAVAHLGAALPGQDWSGA
RALATHPRIAQAAQDAGFGAVRQCRPALNDVVASIESHP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgcgcccccccgcctgcggccccgcgccgcgccatcgtcacccgcccggagcgc
gacgccacgcagtgggtcgtgcacctgcatgcgcgcggcatcgacgccgtggccctgccc
ctcatcgccatccggggatgcgcccatcccgaagcccgcgcggcactgcaggcagcccgc
gaagcctggccccgctggcgcgcggtgatgttcgtgagcagcaacgcggcccactatttc
cttgatccgccaggaacgggcgccgcactcttcgccggcgatccggccgcgctgccgcgg
atctgggcgcccggccccggcaccgcccaggcgctgcggcaggccggcgtgcccgcggaa
gccatcgaccggcccgcggccgaggccacgcagttcgactccgaatccctctgggcacag
gtggcgccgcaggtgcggcagggcgaccgcatcctcatcgtgcgcggcgcgcaggccgac
ggcgacggcacggacaccgtcgcaggcacggggcgcgaatggctcgcgcaacagatcgcc
gcggccggcgggcaggccgaattcgtcgcagcctatgaacgcggcgcccccgacttcagc
gcagagcaactggccctcgcccgcgccgcggccacggacggctcgctctggcttttcagc
agctccgaggcggtggcccacctgggcgcagcactgcccgggcaggactggtccggcgcg
cgcgcgctcgccacccacccccgcatcgcgcaggccgcgcaggacgccggcttcggggcc
gtgcgccagtgccgcccggccctgaacgacgtggtcgcatcgatagaatcccacccatga

DBGET integrated database retrieval system