KEGG   Acidovorax avenae: Acav_3171Help
Entry
Acav_3171         CDS       T01445                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aaa  Acidovorax avenae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acav_3171
   00052 Galactose metabolism
    Acav_3171
   00500 Starch and sucrose metabolism
    Acav_3171
   00520 Amino sugar and nucleotide sugar metabolism
    Acav_3171
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acav_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3614039..3614926
Genome map
AA seq 295 aa AA seqDB search
MSDNSAIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVT
GRSKRAIEDHFDTAYELENELEAAGKNELLQLVRSVAPNDMDCAFVRQPRSLGLGHAVLC
AEPLVGREPFAVLLADDLMVGPPGGQPVMAQMAAAFRKQGRSLLAVQEVPQDQVRRYGIV
AGEPAGGPLIRIERIVEKPAPEDAPSRMGVAGRYILTPGVFDEIRNQPQGVGGEIQLTDA
IARLMAREAVYAFRYEGKRYDCGSKEGFLEATVELALQHPQVGAAFREYLKTVEI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaactccgcgatccgcaaagccgtcttccccgtggccggcctgggcacccgc
ttcctgcccgccacgaaggcatcccccaaggagatgctgccggtggtggacaagccgctg
atccagtacgccgtcgaagaggcctatgcggccggcatccgccacatgatcttcgtcacc
ggccgcagcaagcgcgccatcgaggaccacttcgacaccgcctacgagctggagaacgaa
ctggaagccgccggcaagaacgaactgctgcagctcgtgcgctcggtcgcccccaatgac
atggactgcgccttcgtgcgccagccgcgctccctgggcctgggccatgcggtgctttgc
gccgagccgctcgtgggccgcgaacccttcgccgtgctgctcgcagacgacctcatggtc
ggcccccccggcggccagcccgtcatggcccagatggcggccgccttccgcaagcagggc
cgctcgctgctggccgtgcaggaagtgccgcaggaccaggtgcgccgctacggcatcgtg
gccggcgagcccgccggcggcccgctgatccgcatcgagcgcatcgtcgagaagccggcc
cccgaagatgcgccctcgcgcatgggcgtggccggccgctacatcctcacgccgggcgtg
ttcgacgagatccgcaaccagccccagggcgtgggcggcgagatccagctcaccgatgcc
atcgcccgcctcatggcccgcgaagccgtctatgccttccgctacgaaggcaagcgctac
gactgcggcagcaaggaaggcttcctggaagccacggtggaactcgcgctgcaacatccc
caggtgggcgccgccttccgcgaatacctcaagaccgtggaaatctga

DBGET integrated database retrieval system