KEGG   Acidovorax avenae: Acav_3172Help
Entry
Acav_3172         CDS       T01445                                 

Definition
(GenBank) SirA-like domain-containing protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TusA DUF2249 Ribosomal_S8
Motif
Other DBs
NCBI-ProteinID: ADX47074
JGI: Acav_3172
UniProt: F0Q7K1
Position
complement(3615072..3615299)
Genome map
AA seq 75 aa AA seqDB search
MHIHKEIDTRGLNCPLPILKAKKALASMASGEVLKVVSTDNGSLRDFQAFAKQTGNELLD
QSTAGEEYTHVLRRR
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgcacatccacaaggaaatcgacacccgcgggctcaactgcccgctgcccatcctgaag
gccaagaaggcgctcgcctccatggccagcggcgaggtgctcaaggtggtgtccaccgac
aacggctcgctgcgcgacttccaggcgttcgcgaagcagacgggcaacgaactgctggac
cagagcacggcgggcgaggaatacacccacgtgctgcggcggcgctga

DBGET integrated database retrieval system