KEGG   Acidovorax avenae: Acav_3185Help
Entry
Acav_3185         CDS       T01445                                 

Definition
(GenBank) TrkA-N domain protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase RmlD_sub_bind TrkA_N GDP_Man_Dehyd NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADX47087
JGI: Acav_3185
UniProt: F0Q889
Position
complement(3626020..3626967)
Genome map
AA seq 315 aa AA seqDB search
MPSNLNPLGALPARFRRERVLVVGCGDVGLRAVGALRAVQGSPRPRVLALTSSPGRVAAL
RAAGIVPLPGNLDDARTLRRLAGLATRVLHLAPPPGERDAGAAWWADPRTAALVRALRLR
SMPRALVYGSTSGVYGDCAGALVPETRPVAPATPRARRRVDAERSVRHLGRAGVRASVLR
IPGIYAPDREGGTPEARLRRGTPALVREDDVHTNHIHADDLARACVAALWRGRPQRIYHV
SDASGLKMGDYFDLAADLYGLPRPRRITRAQAREELSPMLLSFMGESRRLDATRLAKELR
VRLRYPTVAEGLRSA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgccctcaaacctgaaccccctcggcgcgctgccagcgcgtttccgccgtgaacgtgtg
ctggtcgtcggctgcggcgacgtgggcctgcgcgcggtgggcgccctgcgggccgtgcag
ggatcgccgcgcccgcgcgtgctggcgctcacctcgagtcccgggcgggtcgcggccctg
cgcgcggccggcatcgtgccgctgccgggcaacctggacgacgcgcgcacgctgcggcgc
ctcgcgggcctggccacgcgcgtcctgcacctggccccgccacccggggagcgcgacgcc
ggcgccgcatggtgggccgatccgcgcacggcggccctggtgcgcgccctgcggctgcgc
agcatgccgcgcgcgctggtgtacggctcgaccagcggggtctatggcgactgcgccggt
gccctcgtgccggaaacccggccggtcgcgccggccactccgcgcgcccgcaggcgcgtg
gatgccgaacgttccgtgcgccacctgggccgggcaggcgtgcgcgcgagcgtgttgcgc
attcccggcatctatgcgcccgaccgcgagggtggcacgccggaggcccggctgcgccgc
ggcacgccggcgctggtgcgcgaggacgacgtgcataccaaccacatccatgccgatgac
ctcgcccgcgcctgcgtcgctgccctctggcgggggcggccccagcgcatctaccacgtg
agcgatgcgagcggcctgaagatgggcgactacttcgacctcgccgccgacctgtacggg
ctgccacgtccgcgcaggatcacgcgggcacaggcccgcgaagagctgtcgccgatgctg
ctgagcttcatgggcgaatcgcgccggctcgatgccacccggcttgcgaaggaattgcgc
gtgcggctgcgctatccgaccgtggccgaaggactccgcagcgcctga

DBGET integrated database retrieval system