KEGG   Acidovorax avenae: Acav_3201Help
Entry
Acav_3201         CDS       T01445                                 

Definition
(GenBank) Protein of unknown function DUF3455
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3455
Motif
Other DBs
NCBI-ProteinID: ADX47103
JGI: Acav_3201
UniProt: F0Q8A5
Position
3641179..3641727
Genome map
AA seq 182 aa AA seqDB search
MRIHLPLAIVATLGLAACSHMGSSPMAAFSQASLPAAVQVPAGHKVALETVGKGEITYEC
RAKKDMPGDFEWVFVGPDAKLQDRKGAMVGRYWGPPATWESNDGSKVTATQVAVAPAGTG
NIPLQLVKANPATGMGAMQGVAYIQRVATQGGVAPAMPCAAGNAGQKQIVKYQADYIFWR
AA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatccatcttcccctcgcgatcgtcgccaccctgggcctggcggcctgcagccac
atgggcagcagccccatggcagcgttctcccaggcctccctgcccgcggcggtgcaggtg
cccgccggccacaaggtggccctggaaaccgtgggcaagggagaaatcacgtacgaatgc
cgcgccaagaaagacatgccgggcgacttcgaatgggtgttcgtcggcccggacgccaag
ctccaggaccgcaagggcgccatggtgggccgctactggggcccgcccgccacctgggaa
agcaatgacggctccaaggtaaccgccacgcaggtggccgtggcgcccgccggcacgggc
aacatcccgctgcaactggtcaaggcgaatcctgccacggggatgggggcgatgcagggc
gtggcctacatccagcgcgtggcgacgcagggcggcgtagcgccggccatgccctgcgcg
gcgggcaatgccgggcagaagcagatcgtgaagtaccaggccgactacatcttctggcgc
gccgcctga

DBGET integrated database retrieval system