KEGG   Acidovorax avenae: Acav_3202Help
Entry
Acav_3202         CDS       T01445                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP
Motif
Other DBs
NCBI-ProteinID: ADX47104
JGI: Acav_3202
UniProt: F0Q8A6
Position
complement(3641800..3643767)
Genome map
AA seq 655 aa AA seqDB search
MADVHSITKSFKNMTHWIGNLKFSRKFVLIGCIAFAMFLLPTVLLMRTTLADVQTALQER
RGLAPARELLKLLQLAQQHRGLSASMLGGTESAAAPRQAKQAEVEASLGRAKQALTGLGD
NTLGQRLDSIQGDWNTLASGVAGKTLRGADSNRLHVALIERMLGLIDDVANSSGLARDTD
IRTHYLQKAVLGQLPQLTESLGQMRARGALVLARGEVAPEERARIEALSDRVRKYYGDAR
KALELAAGGSLPPAVEKARDAALAAAQEGFKLADDNIVKADVLSMPSTDWVARMTRIIDT
QFELVAASFDVLEQSLDDQIAQMRQGMLVLGLVLAALAAAALWIMAMVTRATTRSIGEAV
RIAEAVADGDLTAQVEPQGRDEVARLLHALAAMTRKLGTVVGTVRLNAENVASASVQIAQ
GNTDLSQRTESQASSLEETAASMEELGSTVRQNADNARQADQLARSAAGVAAQGGTVVQQ
VVETMRGIHTSSARIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSL
AQRSASAAKEIKELITASVAQVQSGTALVDQAGTTMTEIVDSIRKVSDIVGEITSATVEQ
SEGVAQVGEAVSQMDNATQQNAALVEESAAAASSLKSQAQQLVDTVAMFRLNAGA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtgcattcgattactaaaagtttcaaaaacatgacccactggatcggcaac
ctgaagttctcacgcaagttcgtcctgatcggctgcatcgccttcgcgatgttcctgctg
cccaccgttttgctgatgcgcaccaccctggccgatgtccagacagcgctgcaggagcgc
aggggcctcgccccggcgcgcgaactcctcaagctgctgcagctggcgcagcagcaccgc
gggctgtccgcctccatgctcgggggaacggaatcggccgctgcgccgcggcaggccaag
caggccgaggtggaggcctccctgggccgcgcgaagcaggcgctcacgggtctgggcgac
aacaccctgggccagcggctcgacagcatccagggcgactggaacacgctggcttccggc
gtggcgggcaagaccttgcgtggcgcggacagcaaccggctgcacgtggcgctcatcgag
cggatgctcggcctcatcgacgacgtggccaacagctccggactcgcccgcgacaccgac
atccgcacccactacctgcagaaggccgtactcgggcagttgccgcagctgacggagtcg
ctcggccagatgcgggcgcgcggcgcgctggtgctggcgcgcggcgaagtggccccggaa
gagcgggcacggatcgaggccctgtccgaccgcgtgcgcaagtactacggcgatgcacgc
aaggcgctcgaactggcggccggcggcagcctgccccccgccgtggaaaaggcccgggac
gctgcgctggccgcggcccaggaagggttcaagctggccgacgacaacatcgtgaaggcc
gacgtgctgagcatgccgtccaccgactgggtcgcgcgcatgacccgcatcatcgacacc
cagttcgagctggtggccgcgtcgttcgacgtgctggaacaatcgctggacgaccagatc
gcgcagatgcgccaaggcatgctggtgctggggctcgtgctggcggcgctggcagcagcg
gccctctggatcatggccatggtcacccgcgccaccacgcgttccatcggcgaggccgtg
cggatcgccgaggccgtggcggacggcgacctgaccgcgcaggtcgagccccagggccgc
gacgaggtggcccggctgctgcacgcactggccgccatgacccgcaagctcggcacggtg
gtgggtacggtgcggctcaatgccgaaaacgtcgccagcgccagcgtgcagatcgcgcag
ggcaacaccgacctgagccagcgcaccgaaagccaggccagctccctggaggagacggcc
gcgtccatggaagagctgggctccaccgtccggcagaacgcggacaacgcgcggcaggcg
gaccagctcgcgcgcagcgcggccggcgtggccgcgcagggtggtaccgtggtgcagcag
gtggtggagacgatgcgcggcatccacacgagctcggcgcgcatcggcgacatcatcggc
gtgatcgacggcatcgcgttccagaccaacatcctggcgctgaacgcggccgtggaggcg
gcgcgtgcgggtgagcagggccggggcttcgcggtggtcgcgggcgaggtgcgcagcctc
gcgcagcgcagcgccagcgccgccaaggagatcaaggagctgatcacggccagcgtcgcc
caggtacagagcggcaccgcgctggtggatcaggccggcaccaccatgaccgagatcgtg
gattcgatccgcaaggtgagcgacatcgtgggcgagatcacttccgccaccgtggagcag
agcgaaggcgtggcgcaggtcggcgaggctgtcagccagatggacaacgccacccagcag
aacgcggcgctggtggaggaaagtgccgcggccgccagcagcctcaagtcgcaggcccag
caactggtcgataccgtggccatgttccggctgaacgccggcgcctga

DBGET integrated database retrieval system